KEGG   Escherichia coli O18 K1 H7 UTI89 (UPEC): UTI89_C2592Help
Entry
UTI89_C2592       CDS       T00338                                 

Gene name
hisQ
Definition
(GenBank) histidine transport system permease protein hisQ
  KO
K10016  histidine transport system permease protein
Organism
eci  Escherichia coli O18:K1:H7 UTI89 (UPEC)
Pathway
eci02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:eci00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    UTI89_C2592 (hisQ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eci02000]
    UTI89_C2592 (hisQ)
Transporters [BR:eci02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    UTI89_C2592 (hisQ)
   Histidine transporter
    UTI89_C2592 (hisQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 DcuC
Motif
Other DBs
NCBI-ProteinID: ABE08059
UniProt: Q1R9A5
Position
complement(2557370..2558056)
Genome map
AA seq 228 aa AA seqDB search
MLYGFSGVILQGALVTLELAISSVVLAVIIGLIGAGGKLSQNRLSGLIFEGYTTLIRGVP
DLVLMLLIFYGLQIALNTVTEAMGVGQIDIDPMVAGIITLGFIYGAYFTETFRGAFMAVP
KGHIEAATAFGFTRGQVFRRIMFPAMMRYALPGIGNNWQVILKSTALVSLLGLEDVVKAT
QLAGKSTWEPFYFAIVCGVIYLVFTTVSNGVLLFLERRYSVGVKRADL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgttgtatgggttttcaggtgttattttacagggtgcgctcgtcacgctggagctggct
atcagctctgtagtgctcgctgtaatcatcggtttaattggcgctggcggtaagctctca
caaaatcggctttcgggccttattttcgaagggtacaccacgctgattcgaggcgtgccg
gatttagtattgatgctgctgattttctacggtttgcagattgcgctaaacacggtgacg
gaggcgatgggcgtcgggcagattgatatcgatccgatggtcgctggtattattactctc
ggttttatctacggtgcttattttaccgaaacgttccgtggcgcgtttatggctgtgccg
aaagggcatatagaggcggcgacggcgttcggttttactcgtgggcaagtgtttcggcgg
atcatgtttccggcgatgatgcgttacgccctgccaggcattggcaacaactggcaggtg
attctcaaatctaccgctttggtttcgttactcggcctggaagatgtggtcaaagccacg
caactggcaggcaaaagtacctgggaaccgttctatttcgccatcgtctgtggcgtgatt
tacctggttttcaccaccgtttccaatggtgtgctgctgttccttgagcgccgctactcc
gtgggtgtgaagagggctgacctgtga

DBGET integrated database retrieval system