KEGG   Escherichia coli O18 K1 H7 UTI89 (UPEC): UTI89_C3161Help
Entry
UTI89_C3161       CDS       T00338                                 

Gene name
truC
Definition
(GenBank) hypothetical protein
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
eci  Escherichia coli O18:K1:H7 UTI89 (UPEC)
Brite
KEGG Orthology (KO) [BR:eci00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:eci03016]
    UTI89_C3161 (truC)
Enzymes [BR:eci01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     UTI89_C3161 (truC)
Transfer RNA biogenesis [BR:eci03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    UTI89_C3161 (truC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: ABE08613
UniProt: Q1R7Q1
Position
complement(3077457..3078239)
Genome map
AA seq 260 aa AA seqDB search
MLEILYQDEWLVAVNKPSGWLVHRSWLDRDEKVVVMQTVRDLIGQHVFTAHRLDRPTSGV
LLMGLSSEAGRLLAQQFEQHQIQKRYHAIVRGWLMEEAVLDYPLVEELDKIADKFAREDK
GPQPAVTHYRGLATVEMPVATGRYPTTRYGLVELEPKTGRKHQLRRHLAHLRHPIIGDSK
HGDLRQNRSGAEHFGLQRLMLHASQLSLTHPFTGEPLTIHAGLDDTWMQALSQFGWRGLL
PENERVEFSAPSGQDGEISS
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgctggaaatactctatcaggatgaatggctggttgcggtaaataaaccctccggctgg
ctggttcaccgcagctggctggatcgcgacgagaaagtagtggtcatgcaaaccgtgcgt
gacctgataggccagcatgtgtttactgctcatcgtctggaccgacccacttctggtgtg
ttgttgatgggattatccagcgaggccggacggctgctggcacaacagtttgaacagcac
caaatccagaaacgttaccatgcgattgtgcgcggctggttgatggaagaagcggtgctg
gattatccactggtggaagaactggacaaaatcgctgataaatttgcccgcgaagataaa
ggcccgcagccagcagtgacgcattatcgcggtctggcgaccgtagaaatgccggtagcg
accggacgttacccgaccacgcgctacggcctggtagaactggagccgaaaaccggacgt
aagcaccagctccgtcgccatcttgcccatttgcgccacccgattattggcgacagcaaa
catggtgatttacgccagaatcgcagcggtgctgaacattttggccttcagcggttaatg
ctgcatgctagtcagttgtcattgacgcatccttttactggcgagccgctgactattcac
gcgggcctggacgacacctggatgcaggcgttatcacaatttggctggcggggtctgctt
cctgaaaatgaaagggttgagttcagtgcgccatcgggtcaggatggagagataagttcc
taa

DBGET integrated database retrieval system