KEGG   Escherichia coli O18 K1 H7 UTI89 (UPEC): UTI89_C3223Help
Entry
UTI89_C3223       CDS       T00338                                 

Gene name
recC
Definition
(GenBank) exodeoxyribonuclease V gamma chain
  KO
K03583  exodeoxyribonuclease V gamma subunit [EC:3.1.11.5]
Organism
eci  Escherichia coli O18:K1:H7 UTI89 (UPEC)
Pathway
eci03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:eci00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    UTI89_C3223 (recC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:eci03400]
    UTI89_C3223 (recC)
Enzymes [BR:eci01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     UTI89_C3223 (recC)
DNA repair and recombination proteins [BR:eci03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     UTI89_C3223 (recC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exonuc_V_gamma RecC_C
Motif
Other DBs
NCBI-ProteinID: ABE08672
UniProt: Q1R7J2
Structure
PDB: 

Position
complement(3149496..3152864)
Genome map
AA seq 1122 aa AA seqDB search
MLRVYHSNRLDVLEALMEFIVERERLDDPFEPEMILVQSTGMAQWLQMTLSQKFGIAANI
DFPLPASFIWDMFVRVLPEIPKESAFNKQSMSWKLMTLLPQLLEREDFTLLRHYLTDDSD
KRKLFQLSSKAADLFDQYLVYRPDWLAQWETGHLVEGLGEAQAWQAPLWKALVEYTDELG
QPRWHRANLYQRFIETLESATTCPPGLPSRVFICGISALPPVYLQALQALGKHIEIHLLF
TNPCRYYWGDIKDPAYLAKLLTRQRRHSFEDRELPLFRDSENAGQLFNSDGEQDVGNPLL
ASWGKLGRDYIYLLSDLESSQELDAFVDVTPDNLLHNIQSDILELENRAVAGVNIEEFSR
SDNKRPLDPLDSSITFHVCHSPQREVEVLHDRLLAMLEEDPTLTPRDIIVMVADIDSYSP
FIQAVFGSAPADRYLPYAISDRRARQSHPVLEAFISLLSLPDSRFVSEDVLALLDVPVLA
ARFDITEEGLRYLRQWVNESGIRWGIDDDNVRELELPATGQHTWRFGLTRMLLGYAMESA
QGEWQSVLPYDESSGLIAELVGHLASLLMQLNIWRRGLAQERPLEEWLPVCRDMLNAFFL
PDAETEAAMTLIEQQWQAIISEGLGAQYGDAVPLSLLRDELALRLDQERISQRFLAGPVN
ICTLMPMRSIPFKVVCLLGMNDGVYPRQLAPLGFDLMSQKPKRGDRSRRDDDRYLFLEAL
ISAQQKLYISYIGRSIQDNSERFPSVLVQELIDYIGQSHYLPGDEALNCDESEARVKAHL
TCHHTRMPFDPQNYQPGNLQSYAREWLPAASQAGKAHSEFVQPLPFTLPETVPLETLQRF
WAHPVRAFFQMRLQVNFRTEDSEIPDTEPFILEGLSRYQINQQLLNVLVEQDDAERLFRR
FRAAGDLPYGAFGEIFWETQCQEMQQLADRVIACRQPGQSMEIDLACNGVQITGWLPQVQ
PDGLLRWRPSLLSVAQGMQLWLEHLVYCASGGNGESRLFLRKDGEWRFPPLAAEQALHYL
SQLIEGYREGMSAPLLVLPESGGAWLKTCYDAQNDAMLDDDSTLQKARTKFLQAYEGNMM
VRGEGDDIWYQRLWRQLTPETMEAIVEQSQRFLLPLFRFNQS
NT seq 3369 nt NT seq  +upstreamnt  +downstreamnt
atgttaagggtctaccattccaatcgtctggacgtgctggaagcgttgatggagtttatt
gtcgaacgcgaacggctggacgatcctttcgaaccagagatgattctggtgcaaagtacc
ggtatggcacagtggctgcaaatgaccctgtcgcaaaagtttggtattgcggcaaacatt
gattttccgctgccagcgagctttatctgggatatgttcgtccgggtgttaccggagatc
cccaaagagagcgcctttaacaaacagagcatgagctggaaactgatgactctgctgccg
caactgttggagcgcgaagactttaccctgttgcggcattatctgactgacgatagtgac
aagcgaaaactgttccagctttcttcaaaagcggcggacctgtttgaccagtatctggtc
tatcgtccggactggctggcacagtgggaaacaggacatctggtagaagggttgggagaa
gcacaggcctggcaagcgccgttgtggaaggcgttggtggaatataccgacgaacttggg
caaccgcgctggcaccgcgccaatctctatcagcgctttatcgaaacgctggagtccgcg
acgacctgcccgccggggttaccttcgcgcgtctttatatgcggtatttccgcgttaccg
cctgtttatctccaggcgctacaggcgctgggtaaacatattgaaatccatctcctgttt
accaacccctgccgttattactggggcgacattaaagatcccgcttatctggcgaaacta
ctgactcgccagcgccgacacagttttgaagatcgcgaattaccgctatttcgcgacagc
gaaaatgccgggcagctctttaacagcgatggtgaacaggatgtcggcaacccgctgctg
gcttcatggggcaagcttgggcgcgactacatttatctcctttctgacctggagagcagc
caggagctggacgcttttgtcgatgtgacgccagataacctgctgcataatattcagtct
gacattctggaactggaaaaccgcgccgttgctggtgtgaacatcgaagagttttcccgt
agcgataacaaacgcccgcttgatccactggatagcagtatcaccttccacgtttgccat
agcccgcagcgtgaagttgaagttttacacgatcgcctgctggcgatgctggaggaagac
ccgacacttactccgcgcgacatcatcgtgatggtggctgatatcgacagctacagtccg
tttattcaggctgtgtttggtagtgcacctgcggatcgttacctgccttacgccatttcc
gaccgtcgggcgcggcagtcgcatcctgtacttgaagcgtttatcagcctgttatcgctg
ccagacagccgctttgtgtcggaagacgtgctggcattactggatgtgccggtgctggca
gcgcggtttgacatcaccgaagaagggctgcgttatttacgtcagtgggtcaacgaatcc
ggcattcgttgggggatagatgacgacaacgttcgcgagctggaacttcccgctaccggt
caacacacctggcggtttggcctgacgcgcatgttgctgggctacgcgatggagagcgcg
cagggcgagtggcaatcggttctaccttatgatgaatcgagcggcttaattgcagaactg
gtggggcatctggcttcactgctaatgcagctaaatatctggcgtcgcgggctggcgcag
gagcgtccgctggaagagtggttgccggtttgtcgcgatatgctcaacgcctttttcctg
ccggatgcggaaaccgaagcggcgatgacgctgatcgaacaacaatggcaggcgattatc
tccgaaggtttaggcgcgcagtatggcgacgcggtgccgctgtcactattgcgtgatgaa
ctggcactgcgcctggatcaagaacgtatcagccagcgttttctcgccggaccggttaac
atttgtactctgatgccaatgcgttcaattccgttcaaagtggtttgcctgctgggaatg
aacgacggcgtttatccacgtcagcttgcgccattgggctttgatctgatgagccagaaa
ccgaagcgtggcgaccgtagccgtcgcgatgacgaccgctatctgttcctggaagcgtta
atttccgcgcagcaaaaactctatatcagctatatcgggcgttccattcaggataacagt
gaacgtttcccgtcggtactggtgcaggaactgatcgactacatcgggcaaagccattat
ctaccgggcgatgaagcgcttaactgtgatgaaagcgaggcaagggtaaaagcgcatctt
acttgccaccatacccggatgccgtttgacccgcaaaactaccagcccggtaacttacaa
agctatgcgcgcgagtggctacctgcggccagccaggctggtaaagcacattctgaattt
gttcagccgctgccgtttaccttaccggaaaccgtgccgctggaaacgctacaacgattc
tgggcacatccggtgcgggcgtttttccagatgcgtttgcaggtgaacttccgtaccgaa
gacagcgaaattcccgacactgaaccttttattcttgaagggcttagtcgttatcaaatc
aaccagcagttattaaatgtactggttgagcaggatgatgccgaacgcttgttccgccga
ttccgggcggcaggtgatttgccgtatggtgcctttggtgaaattttctgggaaacgcag
tgtcaggagatgcagcaacttgccgacagagtcattgcctgtcgccagccagggcagagt
atggagattgatctcgcctgcaacggtgtgcagataactggctggttgccgcaggtgcag
ccggatggcctgttgcgctggcgtccctctttattaagtgtggcgcagggaatgcaactt
tggctggaacaccttgtctactgtgccagcggtggtaatggtgaaagtcgcctttttcta
cgcaaagacggcgagtggcgttttccgccgcttgcagccgaacaggctttgcattacctc
tcacaactgattgaggggtatcgtgaaggaatgtccgcgccattgctggtgttacctgaa
agtggcggcgcgtggctaaaaacctgttatgacgcgcaaaacgatgccatgctggatgac
gattccacgttgcaaaaagcccgtacgaaattccttcaggcttacgaaggcaacatgatg
gtgcgtggcgaaggtgatgatatctggtatcaacggctctggcggcaattaacaccagag
acaatggaggctatcgttgaacagtcgcaacgtttcctgttaccgctgtttcgctttaat
cagtcatga

DBGET integrated database retrieval system