KEGG   Escherichia coli O18 K1 H7 UTI89 (UPEC): UTI89_C3253
Entry
UTI89_C3253       CDS       T00338                                 

Definition
(GenBank) xanthine dehydrogenase iron-sulfur binding subunit
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
eci  Escherichia coli O18:K1:H7 UTI89 (UPEC)
Pathway
eci00230  Purine metabolism
eci01100  Metabolic pathways
eci01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eci00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    UTI89_C3253
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: ABE08701
UniProt: Q1R7G3
Position
3182335..3182814
AA seq 159 aa
MNHSETITIECTINGMPFQLHAAPGMPLSELLREQGLLSVKQGCCVGECGACTVLVDGTA
IDSCLFLAAWAEGKEIRTLEGEAKGGKLSHVQLAYAKSGAVQCGFCTPGLIMATTAMLAK
PREKPLTITEIRRGLAGNLCRCTGYQMIVNTVLDCEKTK
NT seq 480 nt   +upstreamnt  +downstreamnt
atgaatcacagcgaaacaattaccatcgaatgcaccattaacgggatgccttttcagctt
cacgccgcgccaggaatgccgctttcggaactactccgagaacaagggcttcttagtgtc
aaacaaggttgctgcgtaggcgaatgcggtgcctgtacggtgctggtcgacggcacagca
atagacagttgcttattccttgcggcctgggctgaaggaaaagagatccgcacgctggaa
ggtgaagcgaaaggtggaaaactttctcatgttcaactggcttatgcgaaatccggcgca
gtgcaatgcgggttttgtacgccgggcctgattatggctaccacggcgatgctggcaaaa
ccacgcgaaaaaccattaaccattacggaaattcgtcgtggactggcgggaaatctttgt
cgctgcacggggtatcagatgattgtaaatacagttctggattgcgagaaaacgaagtaa

DBGET integrated database retrieval system