KEGG   Escherichia coli O18 K1 H7 UTI89 (UPEC): UTI89_C3451Help
Entry
UTI89_C3451       CDS       T00338                                 

Gene name
qseC
Definition
(GenBank) sensor protein QseC
  KO
K07645  two-component system, OmpR family, sensor histidine kinase QseC [EC:2.7.13.3]
Organism
eci  Escherichia coli O18:K1:H7 UTI89 (UPEC)
Pathway
eci02020  Two-component system
eci02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:eci00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    UTI89_C3451 (qseC)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    UTI89_C3451 (qseC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:eci01001]
    UTI89_C3451 (qseC)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:eci02022]
    UTI89_C3451 (qseC)
Enzymes [BR:eci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     UTI89_C3451 (qseC)
Protein kinases [BR:eci01001]
 Histidine kinases
  OmpR family
   UTI89_C3451 (qseC)
Two-component system [BR:eci02022]
 OmpR family
  QseC-QseB (quorum sensing)
   UTI89_C3451 (qseC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA 2CSK_N HAMP HATPase_c_5
Motif
Other DBs
NCBI-ProteinID: ABE08898
UniProt: Q1R6W6
Structure
PDB: 

Position
3387840..3389189
Genome map
AA seq 449 aa AA seqDB search
MKFTQRLSLRVRLTLIFLILASVTWLLSSFVAWKQTTDNVDELFDTQLMLFAKRLSTLDL
NEINAADRMAQTPNKLKHGHVDDDALTFAIFTHDGRMVLNDGDNGEDIPYSYQREGFADG
QLVGEDDPWRFVWMTSPDGKYRIVVGQEWEYREDMALAIVAGQLIPWLVALPIMLIIMMV
LLGRELAPLNKLALALRMRDPDSEKPLNATGVPSEVRPLVESLNQLFARTHAMMVRERRF
TSDAAHELRSPLTALKVQTEVAQLSDDDPQARKKALLQLHSGIDRATRLVDQLLTLSRLD
SLDNLQDVAEIPLEDLLQSSVMDIYHTAQQANIDVRLTLNANGIKRTGQPLLLSLLVRNL
LDNAVRYSPQGSVVDVTLNADNFIVRDNGPGVTPEALARIGERFYRPPGQTATGSGLGLS
IVQRIAKLHDMNVEFGNAEQGGFEAKVSW
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttacccaacgtcttagtctgcgagtcaggctgacgctaatctttttaattctg
gcctcggtgacctggctgctttccagctttgtcgcctggaaacaaacaacggataacgtc
gatgagttgttcgacacccaactgatgctgtttgccaaacggttaagtacgctcgatctc
aacgaaatcaacgcggcggatcgcatggcacagacgccaaataaattaaaacacggtcat
gttgatgacgatgcgctgacttttgccatctttacccacgacggcagaatggtccttaac
gatggcgataacggagaagatattccctatagctatcagcgggaaggttttgctgacggg
caactggtcggtgaagacgatccctggcgttttgtctggatgacctcacctgatggcaaa
tatcgcatcgttgtgggtcaggaatgggaataccgtgaagacatggcgctggcgattgtt
gccggacaattgatcccgtggctggtcgcactgccgattatgttaatcatcatgatggta
ctactgggtcgtgaactcgcgccgctgaacaaattggcgctggcactacgtatgcgtgac
ccagactcggaaaaaccactaaacgcgacgggcgtacccagcgaagtgcgcccactggtt
gagtcgctaaatcaactgttcgcccgcacacatgcgatgatggttcgtgaacgacgcttt
acctccgacgcagctcacgaacttcgtagcccgttaacggcgctgaaagtgcaaaccgaa
gttgctcagctctctgacgatgatccgcaggcgcggaaaaaagcgctgctccaattacat
tccgggatcgatcgcgctactcgtctggttgatcaactgctcacgctatcgcggctggac
tcactggataaccttcaggacgtcgcggagatcccgcttgaagatctcctgcaatcgtcg
gtgatggatatttaccacacggcgcagcaggcgaacattgacgtgcgactgacactcaat
gccaacggcatcaaacgcaccggacaaccgctattgctaagtttgttggtgcgaaatttg
ctggataacgccgtgcgttacagtccacaaggtagcgtggtagacgtcacgctgaatgcc
gataatttcatcgtgagggataacggccccggtgtgacgccagaggcactggcgcgaatt
ggcgaacgcttctatcgcccacccggacaaaccgctaccggcagtggacttgggctatcg
attgtccagcgaatcgccaagctgcatgacatgaatgttgaatttgggaatgcggaacaa
ggtggatttgaggcgaaggtaagctggtaa

DBGET integrated database retrieval system