KEGG   Escherichia coli O18 K1 H7 UTI89 (UPEC): UTI89_C4126Help
Entry
UTI89_C4126       CDS       T00338                                 

Gene name
sgbU
Definition
(GenBank) putative hexulose-6-phosphate isomerase
  KO
K03079  L-ribulose-5-phosphate 3-epimerase [EC:5.1.3.22]
Organism
eci  Escherichia coli O18:K1:H7 UTI89 (UPEC)
Pathway
eci00040  Pentose and glucuronate interconversions
eci00053  Ascorbate and aldarate metabolism
eci01100  Metabolic pathways
eci01120  Microbial metabolism in diverse environments
Module
eci_M00550  Ascorbate degradation, ascorbate => D-xylulose-5P
Brite
KEGG Orthology (KO) [BR:eci00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    UTI89_C4126 (sgbU)
   00053 Ascorbate and aldarate metabolism
    UTI89_C4126 (sgbU)
Enzymes [BR:eci01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.22  L-ribulose-5-phosphate 3-epimerase
     UTI89_C4126 (sgbU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2 Glyco_hydro_114 UxuA Methyltransf_11 PRMT5_TIM DPRP
Motif
Other DBs
NCBI-ProteinID: ABE09554
UniProt: Q1R510
Position
4015894..4016787
Genome map
AA seq 297 aa AA seqDB search
MRKSTPSGEASVRNHPLGIYEKALAKDLSWPERLVLAKSCGFDFVEMSVDETDERLSRLD
WSAAQRASLVTAMIETGVAIPSMCLSAHRRFPFGSRDDAVRQRAREIMSKAIRLARDLGI
RTIQLAGYDVYYEDHDEGTQQRFAEGLAWAVEQAAASQVMLAVEIMDTAFMNSISKWKKW
DEMLASPWFTVYPDVGNLSAWGNDVPAELKLGIDRIAAIHLKDTQPVTEHSPGQFRDVPF
GEGCVDFVGIFKTLHELNYRGSFLIEMWTEKAKEPVLEIIQARRWIEARMQEAGFIC
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaatcgactccatctggggaggcaagcgtgcgtaatcatccgttaggcatttat
gaaaaagcgctggcgaaagatctctcctggccggagcggctggtgctggcaaaaagctgt
ggttttgattttgtcgaaatgtcggtggatgaaaccgacgaacggttgtcacgtcttgac
tggagcgccgcacaacgtgcttcgctggtcactgcgatgatcgaaacgggtgttgctatt
ccgtcaatgtgcctgtccgcacatcgtcgttttccttttggtagccgggacgacgccgtg
cgccagcgggcgcgggagattatgagtaaagcgattcgcctggcgcgcgatctcggcatt
cgtactattcaactggcaggttacgacgtctattacgaggatcatgacgaaggcacccag
caacggtttgctgaagggctggcgtgggcggttgaacaggcagcggcatcacaagtcatg
ctggcggtggagattatggacaccgcgtttatgaactctatcagcaaatggaaaaagtgg
gacgaaatgcttgcgtcaccgtggttcaccgtttacccggacgtaggcaatctcagcgcc
tggggcaatgatgttcccgccgaactgaaactgggcatcgaccgtatcgccgccatccac
ctgaaagacactcaacccgttaccgaacatagccccggacagttccgcgatgtgccgttt
ggcgaaggctgtgtcgattttgttggcatcttcaaaacgctgcatgagctgaactatcgc
ggatcatttctgattgaaatgtggaccgaaaaagccaaagagccggtgctggagattatt
caggcgcggcgctggattgaagcgcgtatgcaggaggccggatttatatgttag

DBGET integrated database retrieval system