KEGG   Escherichia coli O18 K1 H7 UTI89 (UPEC): UTI89_P128Help
Entry
UTI89_P128        CDS       T00338                                 

Gene name
traQ
Definition
(GenBank) F pilin synthesis protein
Organism
eci  Escherichia coli O18:K1:H7 UTI89 (UPEC)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TraQ DLP_helical Herpes_LMP1
Motif
Other DBs
NCBI-ProteinID: ABE10704
UniProt: Q1R1R0
Position
pUTI89:95212..95496
Genome map
AA seq 94 aa AA seqDB search
MISKRRFSLPRLDITGMWVFSLGVWFHIVARLVYSKPWMAFFLAELIAAILVLFGAYQVL
DAWIARVSLEEREALEARQQAMMEGQQEGGHVSH
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atgataagtaaacgcagattctctttaccacggcttgatattacgggaatgtgggtattt
tccctgggtgtctggtttcatatcgtcgcccgtcttgtttacagcaaaccctggatggct
ttttttctggcggagttgattgcggccatccttgtgctgttcggcgcataccaggtgctg
gatgcatggattgcacgtgtcagcctggaagagcgtgaggcactggaagccaggcaacag
gccatgatggaagggcagcaggagggcggacatgtctctcactaa

DBGET integrated database retrieval system