KEGG   Escherichia coli K-12 W3110: JW0002Help
Entry
JW0002            CDS       T00068                                 

Gene name
thrB
Definition
(GenBank) homoserine kinase
  KO
K00872  homoserine kinase [EC:2.7.1.39]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj00260  Glycine, serine and threonine metabolism
ecj01100  Metabolic pathways
ecj01110  Biosynthesis of secondary metabolites
ecj01120  Microbial metabolism in diverse environments
ecj01230  Biosynthesis of amino acids
Module
ecj_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    JW0002 (thrB)
Enzymes [BR:ecj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.39  homoserine kinase
     JW0002 (thrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: BAB96580
UniProt: P00547
Position
2801..3733
Genome map
AA seq 310 aa AA seqDB search
MVKVYAPASSANMSVGFDVLGAAVTPVDGALLGDVVTVEAAETFSLNNLGRFADKLPSEP
RENIVYQCWERFCQELGKQIPVAMTLEKNMPIGSGLGSSACSVVAALMAMNEHCGKPLND
TRLLALMGELEGRISGSIHYDNVAPCFLGGMQLMIEENDIISQQVPGFDEWLWVLAYPGI
KVSTAEARAILPAQYRRQDCIAHGRHLAGFIHACYSRQPELAAKLMKDVIAEPYRERLLP
GFRQARQAVAEIGAVASGISGSGPTLFALCDKPETAQRVADWLGKNYLQNQEGFVHICRL
DTAGARVLEN
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggttaaagtttatgccccggcttccagtgccaatatgagcgtcgggtttgatgtgctc
ggggcggcggtgacacctgttgatggtgcattgctcggagatgtagtcacggttgaggcg
gcagagacattcagtctcaacaacctcggacgctttgccgataagctgccgtcagaacca
cgggaaaatatcgtttatcagtgctgggagcgtttttgccaggaactgggtaagcaaatt
ccagtggcgatgaccctggaaaagaatatgccgatcggttcgggcttaggctccagtgcc
tgttcggtggtcgcggcgctgatggcgatgaatgaacactgcggcaagccgcttaatgac
actcgtttgctggctttgatgggcgagctggaaggccgtatctccggcagcattcattac
gacaacgtggcaccgtgttttctcggtggtatgcagttgatgatcgaagaaaacgacatc
atcagccagcaagtgccagggtttgatgagtggctgtgggtgctggcgtatccggggatt
aaagtctcgacggcagaagccagggctattttaccggcgcagtatcgccgccaggattgc
attgcgcacgggcgacatctggcaggcttcattcacgcctgctattcccgtcagcctgag
cttgccgcgaagctgatgaaagatgttatcgctgaaccctaccgtgaacggttactgcca
ggcttccggcaggcgcggcaggcggtcgcggaaatcggcgcggtagcgagcggtatctcc
ggctccggcccgaccttgttcgctctgtgtgacaagccggaaaccgcccagcgcgttgcc
gactggttgggtaagaactacctgcaaaatcaggaaggttttgttcatatttgccggctg
gatacggcgggcgcacgagtactggaaaactaa

DBGET integrated database retrieval system