KEGG   Escherichia coli K-12 W3110: JW0105Help
Entry
JW0105            CDS       T00068                                 

Gene name
nadC
Definition
(GenBank) quinolinate phosphoribosyltransferase
  KO
K00767  nicotinate-nucleotide pyrophosphorylase (carboxylating) [EC:2.4.2.19]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj00760  Nicotinate and nicotinamide metabolism
ecj01100  Metabolic pathways
Module
ecj_M00115  NAD biosynthesis, aspartate => NAD
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    JW0105 (nadC)
Enzymes [BR:ecj01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.19  nicotinate-nucleotide diphosphorylase (carboxylating)
     JW0105 (nadC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: QRPTase_C QRPTase_N IMPDH PEP_mutase Ribul_P_3_epim IGPS Biotin_lipoyl
Motif
Other DBs
NCBI-ProteinID: BAE76041
UniProt: P30011
Position
complement(117752..118645)
Genome map
AA seq 297 aa AA seqDB search
MPPRRYNPDTRRDELLERINLDIPGAVAQALREDLGGTVDANNDITAKLLPENSRSHATV
ITRENGVFCGKRWVEEVFIQLAGDDVTIIWHVDDGDVINANQSLFELEGPSRVLLTGERT
ALNFVQTLSGVASKVRHYVELLEGTNTQLLDTRKTLPGLRSALKYAVLCGGGANHRLGLS
DAFLIKENHIIASGSVRQAVEKASWLHPDAPVEVEVENLEELDEALKAGADIIMLDNFET
EQMREAVKRTNGKALLEVSGNVTDKTLREFAETGVDFISVGALTKHVQALDLSMRFR
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgccgcctcgccgctataaccctgacacccgacgtgacgagctgctggaacgcattaat
ctcgatatccccggcgcggtggcccaggcgctgcgggaagatttaggcggaacagtcgat
gccaacaatgatattacggcaaaacttttaccggaaaattctcgctctcatgccacggtg
atcacccgcgagaatggcgtcttttgcggcaaacgctgggttgaagaggtgtttattcaa
ctggcaggcgacgatgtcaccataatctggcatgtggatgacggcgatgtcatcaatgcc
aatcaatccttgttcgaacttgaaggcccatcccgcgtgctgttaacgggcgaacgcact
gcgcttaattttgtgcaaaccctttcaggagttgccagtaaggtacgccactatgtcgaa
ttgctggaaggcaccaacacgcagttgttggatacgcgcaaaaccttacccggcctgcgt
tcagctctgaaatacgcggtactttgcggcggcggagcgaatcaccgtctggggctttct
gatgccttcctgatcaaagaaaaccatattattgcctccggctcagtgcgccaggcggtc
gaaaaagcgtcctggctgcacccggatgcgccagtagaagtcgaagtagagaatctggaa
gaacttgatgaagccctgaaagcaggagccgatatcatcatgctggataacttcgaaaca
gaacagatgcgcgaagccgtcaaacgcaccaacggcaaggcgctactggaagtgtctggc
aacgtcactgacaaaacactgcgtgaatttgccgaaacgggcgtggactttatctccgtc
ggtgcgctaactaaacacgtacaagcactcgacctttcaatgcgttttcgctaa

DBGET integrated database retrieval system