KEGG   Escherichia coli K-12 W3110: JW0108
Entry
JW0108            CDS       T00068                                 
Symbol
aroP
Name
(GenBank) aromatic amino acid transporter
  KO
K11734  aromatic amino acid transport protein AroP
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW0108 (aroP)
Transporters [BR:ecj02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   JW0108 (aroP)
SSDB
Motif
Pfam: AA_permease AA_permease_2
Other DBs
NCBI-ProteinID: BAB96681
UniProt: P15993
Position
complement(120178..121551)
AA seq 457 aa
MMEGQQHGEQLKRGLKNRHIQLIALGGAIGTGLFLGSASVIQSAGPGIILGYAIAGFIAF
LIMRQLGEMVVEEPVAGSFSHFAYKYWGSFAGFASGWNYWVLYVLVAMAELTAVGKYIQF
WYPEIPTWVSAAVFFVVINAINLTNVKVFGEMEFWFAIIKVIAVVAMIIFGGWLLFSGNG
GPQATVSNLWDQGGFLPHGFTGLVMMMAIIMFSFGGLELVGITAAEADNPEQSIPKATNQ
VIYRILIFYIGSLAVLLSLMPWTRVTADTSPFVLIFHELGDTFVANALNIVVLTAALSVY
NSCVYCNSRMLFGLAQQGNAPKALASVDKRGVPVNTILVSALVTALCVLINYLAPESAFG
LLMALVVSALVINWAMISLAHMKFRRAKQEQGVVTRFPALLYPLGNWICLLFMAAVLVIM
LMTPGMAISVYLIPVWLIVLGIGYLFKEKTAKAVKAH
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgatggaaggtcaacagcacggcgagcagctaaagcgcggccttaaaaaccgccatatt
cagcttatcgcgctgggtggcgcgatagggaccgggttattcctgggtagcgcctccgta
atacagtccgcagggccagggattatcctgggttacgccattgctggttttatcgccttt
ctgatcatgcgtcagctgggtgaaatggtggtcgaagaacctgtcgcaggctcctttagc
cactttgcttataaatactggggcagttttgccggtttcgcctctggctggaactactgg
gtactgtacgttttagttgccatggctgagctgactgccgtgggtaaatacattcagttc
tggtatccggaaatccccacctgggtttctgccgccgtattctttgtggtgattaacgcc
atcaacctgaccaacgttaaagtgtttggcgagatggagttctggtttgccattatcaaa
gttatcgcggtggtagcgatgatcatcttcggcggctggctgctattcagtggcaacggc
ggcccgcaggcgaccgttagcaacctgtgggatcagggtggtttcctgccgcacggcttc
accgggctggtgatgatgatggcgattatcatgttctcgttcggtggtctggaactggtg
gggatcaccgcagcagaagctgataacccggagcaaagtataccgaaagcaactaaccag
gttatctaccgcatcctgattttctatattggttcgttagccgttctgctctcactgatg
ccgtggacccgcgttaccgccgataccagtccgtttgtgctgatcttccacgagttaggc
gatacctttgtggcgaatgcgctgaacatcgtggtactgactgcggcgctctccgtgtac
aacagctgcgtatattgcaacagccgtatgctgtttggtctggcacaacagggtaatgcg
ccaaaagcgctggcgtctgtcgataaacgtggtgtaccagtaaataccattctggtgtct
gcactggtaacggcgttgtgcgtactgattaactaccttgccccagagtccgctttcgga
ctgttaatggcgctggtggtatctgcactggtaatcaactgggcgatgattagcctggcg
catatgaaattccgtcgcgccaagcaggaacaaggcgtggtaactcgcttccctgctctg
ctttatccgctgggtaactggatctgcctgctgtttatggcggcggtactggtgattatg
ctgatgaccccaggaatggcgatttcggtatacctgatcccggtatggctgatcgtgtta
ggtatcggctatctgtttaaagagaaaaccgccaaagccgtaaaagcgcattaa

DBGET integrated database retrieval system