KEGG   Escherichia coli K-12 W3110: JW0132
Entry
JW0132            CDS       T00068                                 

Gene name
yadK
Definition
(GenBank) predicted fimbrial-like adhesin protein
Organism
ecj  Escherichia coli K-12 W3110
SSDB
Motif
Pfam: Fimbrial
Other DBs
NCBI-ProteinID: BAB96713
UniProt: P37016
Position
complement(151003..151599)
AA seq 198 aa
MHPTQRKLMKRIILFLSLLFCIACPAIAGQDIDLVANVKNSTCKSGISNQGNIDLGVVGV
GYFSGNVTPESYQPGGKEFTITVSDCALQGTGDVLNQLHIDFRALSGVMAAGSRQIFANE
ISSGASNVGVVIFSTQDSANTFNVLNASGGSRSVYPVMSDDMNGSSWKFSTRMQKIDPAL
SVTSGQLMSHVLVDIYYE
NT seq 597 nt   +upstreamnt  +downstreamnt
atgcatcccactcaacgtaagctgatgaagagaataattctgtttctgtcattactgttt
tgcatcgcctgtccagccattgctggacaggatattgaccttgttgccaatgtaaaaaac
agcacctgcaaaagcggaatcagtaaccagggtaatattgatcttggcgtcgttggggtg
ggatatttttcaggtaatgttactcctgaaagttatcaaccaggtggaaaagagttcact
atcactgtatccgactgtgcattacagggaactggcgatgtgctaaatcagttacatatt
gattttagagcccttagcggtgtcatggctgctggctctaggcaaatatttgctaatgaa
atttcgtcaggagcaagtaatgtaggagtagttatattttctactcaggattcggcgaat
acattcaatgttcttaatgcttcaggcggatctcgttccgtttatccagtaatgtcggat
gacatgaatggttcatcctggaaatttagcacccgaatgcaaaaaatcgatcctgcattg
agtgttacatctggtcaacttatgagccatgtgttagtggatatttactacgaataa

DBGET integrated database retrieval system