KEGG   Escherichia coli K-12 W3110: JW0168
Entry
JW0168            CDS       T00068                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj00900  Terpenoid backbone biosynthesis
ecj01100  Metabolic pathways
ecj01110  Biosynthesis of secondary metabolites
Module
ecj_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    JW0168 (dxr)
Enzymes [BR:ecj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     JW0168 (dxr)
SSDB
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C
Other DBs
NCBI-ProteinID: BAA77848
UniProt: P45568
Structure
PDB: 

Position
193521..194717
AA seq 398 aa
MKQLTILGSTGSIGCSTLDVVRHNPEHFRVVALVAGKNVTRMVEQCLEFSPRYAVMDDEA
SAKLLKTMLQQQGSRTEVLSGQQAACDMAALEDVDQVMAAIVGAAGLLPTLAAIRAGKTI
LLANKESLVTCGRLFMDAVKQSKAQLLPVDSEHNAIFQSLPQPIQHNLGYADLEQNGVVS
ILLTGSGGPFRETPLRDLATMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEARWLFN
ASASQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIAHTMAWPNRVNSGVKPLDFC
KLSALTFAAPDYDRYPCLKLAMEAFEQGQAATTALNAANEITVAAFLAQQIRFTDIAALN
LSVLEKMDMREPQCVDDVLSVDANAREVARKEVMRLAS
NT seq 1197 nt   +upstreamnt  +downstreamnt
atgaagcaactcaccattctgggctcgaccggctcgattggttgcagcacgctggacgtg
gtgcgccataatcccgaacacttccgcgtagttgcgctggtggcaggcaaaaatgtcact
cgcatggtagaacagtgcctggaattctctccccgctatgccgtaatggacgatgaagcg
agtgcgaaacttcttaaaacgatgctacagcaacagggtagccgcaccgaagtcttaagt
gggcaacaagccgcttgcgatatggcagcgcttgaggatgttgatcaggtgatggcagcc
attgttggcgctgctgggctgttacctacgcttgctgcgatccgcgcgggtaaaaccatt
ttgctggccaataaagaatcactggttacctgcggacgtctgtttatggacgccgtaaag
cagagcaaagcgcaattgttaccggtcgatagcgaacataacgccatttttcagagttta
ccgcaacctatccagcataatctgggatacgctgaccttgagcaaaatggcgtggtgtcc
attttacttaccgggtctggtggccctttccgtgagacgccattgcgcgatttggcaaca
atgacgccggatcaagcctgccgtcatccgaactggtcgatggggcgtaaaatttctgtc
gattcggctaccatgatgaacaaaggtctggaatacattgaagcgcgttggctgtttaac
gccagcgccagccagatggaagtgctgattcacccgcagtcagtgattcactcaatggtg
cgctatcaggacggcagtgttctggcgcagctgggggaaccggatatgcgtacgccaatt
gcccacaccatggcatggccgaatcgcgtgaactctggcgtgaagccgctcgatttttgc
aaactaagtgcgttgacatttgccgcaccggattatgatcgttatccatgcctgaaactg
gcgatggaggcgttcgaacaaggccaggcagcgacgacagcattgaatgccgcaaacgaa
atcaccgttgctgcttttcttgcgcaacaaatccgctttacggatatcgctgcgttgaat
ttatccgtactggaaaaaatggatatgcgcgaaccacaatgtgtggacgatgtgttatct
gttgatgcgaacgcgcgtgaagtcgccagaaaagaggtgatgcgtctcgcaagctga

DBGET integrated database retrieval system