KEGG   Escherichia coli K-12 W3110: JW0178Help
Entry
JW0178            CDS       T00068                                 

Gene name
rnhB
Definition
(GenBank) ribonuclease HII, degrades RNA of DNA-RNA hybrids
  KO
K03470  ribonuclease HII [EC:3.1.26.4]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj03030  DNA replication
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    JW0178 (rnhB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ecj03032]
    JW0178 (rnhB)
Enzymes [BR:ecj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.4  ribonuclease H
     JW0178 (rnhB)
DNA replication proteins [BR:ecj03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    RNase H
     JW0178 (rnhB)
   Elongation factors (archaeal)
     JW0178 (rnhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNase_HII
Motif
Other DBs
NCBI-ProteinID: BAA77858
UniProt: P10442
Position
204493..205089
Genome map
AA seq 198 aa AA seqDB search
MIEFVYPHTQLVAGVDEVGRGPLVGAVVTAAVILDPARPIAGLNDSKKLSEKRRLALYEE
IKEKALSWSLGRAEPHEIDELNILHATMLAMQRAVAGLHIAPEYVLIDGNRCPKLPMPAM
AVVKGDSRVPEISAASILAKVTRDAEMAALDIVFPQYGFAQHKGYPTAFHLEKLAEHGAT
EHHRRSFGPVKRALGLAS
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaatttgtttatccgcacacgcagctggttgcgggtgtggatgaagtcggacgc
gggccgttagttggcgcggtcgtcaccgctgcggtgatccttgacccggcgcgcccgatt
gccgggctgaatgattccaaaaagctgagcgaaaaacgccgtctggcgctctatgaagag
atcaaagagaaagcgttgagctggagtctgggccgcgcggaaccccacgaaatcgacgag
ctgaacattcttcatgcgaccatgctggcgatgcagcgtgccgtcgctgggctgcatatt
gcgccggaatatgtgttgattgatggtaaccgctgcccgaaattaccgatgcctgcgatg
gctgtggtgaaaggcgatagccgcgtaccggaaatcagtgccgcgtctatcctggcgaaa
gtgacgcgtgacgccgaaatggcggcgctggatattgttttcccgcaatatggttttgcc
caacacaaagggtacccaaccgcttttcatctggaaaaactggctgaacacggcgcgacc
gaacaccatcggcgcagctttgggcctgtcaaacgcgcactgggacttgcgtcctga

DBGET integrated database retrieval system