KEGG   Escherichia coli K-12 W3110: JW0205Help
Entry
JW0205            CDS       T00068                                 

Gene name
dnaQ
Definition
(GenBank) DNA polymerase III epsilon subunit
  KO
K02342  DNA polymerase III subunit epsilon [EC:2.7.7.7]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj03030  DNA replication
ecj03430  Mismatch repair
ecj03440  Homologous recombination
Module
ecj_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    JW0205 (dnaQ)
   03430 Mismatch repair
    JW0205 (dnaQ)
   03440 Homologous recombination
    JW0205 (dnaQ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ecj03032]
    JW0205 (dnaQ)
   03400 DNA repair and recombination proteins [BR:ecj03400]
    JW0205 (dnaQ)
Enzymes [BR:ecj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     JW0205 (dnaQ)
DNA replication proteins [BR:ecj03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     JW0205 (dnaQ)
DNA repair and recombination proteins [BR:ecj03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     JW0205 (dnaQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNase_T DUF5051 DNA_pol_A_exo1 vATP-synt_AC39
Motif
Other DBs
NCBI-ProteinID: BAA77886
UniProt: P03007
Structure
PDB: 

Position
236067..236798
Genome map
AA seq 243 aa AA seqDB search
MSTAITRQIVLDTETTGMNQIGAHYEGHKIIEIGAVEVVNRRLTGNNFHVYLKPDRLVDP
EAFGVHGIADEFLLDKPTFAEVADEFMDYIRGAELVIHNAAFDIGFMDYEFSLLKRDIPK
TNTFCKVTDSLAVARKMFPGKRNSLDALCARYEIDNSKRTLHGALLDAQILAEVYLAMTG
GQTSMAFAMEGETQQQQGEATIQRIVRQASKLRVVFATDEEIAAHEARLDLVQKKGGSCL
WRA
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgagcactgcaattacacgccagatcgttctcgataccgaaaccaccggtatgaaccag
attggtgcgcactatgaaggccacaagatcattgagattggtgccgttgaagtggtgaac
cgtcgcctgacgggcaataacttccatgtttatctcaaacccgatcggctggtggatccg
gaagcctttggcgtacatggtattgccgatgaatttttgctcgataagcccacgtttgcc
gaagtagccgatgagttcatggactatattcgcggcgcggagttggtgatccataacgca
gcgttcgatatcggctttatggactacgagttttcgttgcttaagcgcgatattccgaag
accaatactttctgtaaggtcaccgatagccttgcggtggcgaggaaaatgtttcccggt
aagcgcaacagcctcgatgcgttatgtgctcgctacgaaatagataacagtaaacgaacg
ctgcacggggcattactcgatgcccagatccttgcggaagtttatctggcgatgaccggt
ggtcaaacgtcgatggcttttgcgatggaaggagagacacaacagcaacaaggtgaagca
acaattcagcgcattgtacgtcaggcaagtaagttacgcgttgtttttgcgacagatgaa
gagattgcagctcatgaagcccgtctcgatctggtgcagaagaaaggcggaagttgcctc
tggcgagcataa

DBGET integrated database retrieval system