KEGG   Escherichia coli K-12 W3110: JW0306Help
Entry
JW0306            CDS       T00068                                 

Gene name
betT
Definition
(GenBank) choline transporter of high affinity
  KO
K02168  choline/glycine/proline betaine transport protein
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW0306 (betT)
Transporters [BR:ecj02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   JW0306 (betT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BCCT
Motif
Other DBs
NCBI-ProteinID: BAE76097
UniProt: P0ABC9
Position
328687..330720
Genome map
AA seq 677 aa AA seqDB search
MTDLSHSREKDKINPVVFYTSAGLILLFSLTTILFRDFSALWIGRTLDWVSKTFGWYYLL
AATLYIVFVVCIACSRFGSVKLGPEQSKPEFSLLSWAAMLFAAGIGIDLMFFSVAEPVTQ
YMQPPEGAGQTIEAARQAMVWTLFHYGLTGWSMYALMGMALGYFSYRYNLPLTIRSALYP
IFGKRINGPIGHSVDIAAVIGTIFGIATTLGIGVVQLNYGLSVLFDIPDSMAAKAALIAL
SVIIATISVTSGVDKGIRVLSELNVALALGLILFVLFMGDTSFLLNALVLNVGDYVNRFM
GMTLNSFAFDRPVEWMNNWTLFFWAWWVAWSPFVGLFLARISRGRTIRQFVLGTLIIPFT
FTLLWLSVFGNSALYEIIHGGAAFAEEAMVHPERGFYSLLAQYPAFTFSASVATITGLLF
YVTSADSGALVLGNFTSQLKDINSDAPGWLRVFWSVAIGLLTLGMLMTNGISALQNTTVI
MGLPFSFVIFFVMAGLYKSLKVEDYRRESANRDTAPRPLGLQDRLSWKKRLSRLMNYPGT
RYTKQMMETVCYPAMEEVAQELRLRGAYVELKSLPPEEGQQLGHLDLLVHMGEEQNFVYQ
IWPQQYSVPGFTYRARSGKSTYYRLETFLLEGSQGNDLMDYSKEQVITDILDQYERHLNF
IHLHREAPGHSVMFPDA
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atgacagacctttcacacagcagggaaaaggacaaaatcaatccggtggtgttttacacc
tccgccggactgattttgttgttttccctgacaacgatcctgtttcgcgacttctcggcc
ctgtggattggccgcacgctggactgggtttctaaaaccttcggttggtactatctgctg
gcggcaacgctctatattgtctttgtggtctgtatcgcttgttcgcgttttggttcggtg
aagctcgggccagaacaatccaaaccggaattcagcctgctgagttgggcggcgatgctg
tttgctgccgggatcggtatcgacctgatgttcttctccgtagccgaaccggtaacgcag
tatatgcagccgccggaaggcgcgggacagacgattgaggccgcgcgtcaggcgatggtc
tggacgctgtttcactacggcttaaccggctggtcgatgtatgcgctgatgggcatggcg
ctcggatactttagctatcgttataatttgccgctcaccatccgctcggcgctgtacccg
atcttcggtaaacggattaacgggccgataggtcactcagtggatattgcagcggtgatc
ggcactatcttcggtattgccactacgctcggtatcggtgtggtgcagcttaactatggc
ttgagcgtactgtttgatattcccgattcgatggcggcgaaagcggcactgatcgccttg
tcggtgataatcgccacgatctctgtcacctccggtgtcgataagggcattcgcgtgtta
tcggagcttaatgtcgcgctggcgctgggattgatcctgttcgtattgtttatgggcgac
acttcgttcctgcttaatgcactggtgctgaatgttggcgactatgtgaatcgctttatg
ggcatgacgctcaacagttttgccttcgaccgtccggttgagtggatgaataactggacg
ctcttcttctgggcatggtgggtggcatggtcgccgtttgtcggcttgttcctggcgcgt
atctcgcgtgggcgtaccattcgccagttcgtgctgggcacgttgattattccgtttacc
ttcacgctgttatggctctcggtgttcggcaatagcgcgctgtatgaaatcatccacggc
ggcgcggcatttgccgaggaagcgatggtccatccggagcgcggcttctacagcctgctg
gcgcagtatccggcgtttacctttagcgcctccgtcgccaccattactggcctgctgttt
tatgtgacctcggcggactccggggcgctggtgctggggaatttcacctcgcagcttaaa
gatatcaacagcgacgcccccggctggctgcgcgtcttctggtcggtggcgattggcctg
ctgacgctcggcatgctgatgactaacgggatatccgcgctgcaaaacaccacggtgatt
atggggctgccgttcagctttgtgatcttcttcgtgatggcggggttgtataaatctctg
aaggtagaagattaccgccgtgaaagtgccaaccgcgataccgcaccgcgaccgctgggg
cttcaggatcgcctgagctggaaaaaacgtctctcgcgcctgatgaattatccgggcacg
cgttacactaaacagatgatggagacggtctgttacccggcaatggaagaagtggcgcag
gagttgcggttgcgcggcgcgtacgtggagctaaaaagcctgccaccggaagagggacag
cagttgggtcatctggatttgttggtgcatatgggcgaagagcaaaactttgtctatcag
atttggccgcagcaatattcggtgccgggctttacctaccgcgcacgcagcggtaaatcg
acctactaccggctggaaaccttcctgttagaaggcagccagggcaacgacctgatggac
tacagcaaagagcaggtgatcaccgatattcttgaccagtacgagcggcaccttaacttt
attcatctccatcgtgaagcgccgggccatagcgtgatgttcccggacgcgtga

DBGET integrated database retrieval system