KEGG   Escherichia coli K-12 W3110: JW0320
Entry
JW0320            CDS       T00068                                 

Gene name
yahN
Definition
(GenBank) neutral amino-acid efflux system
  KO
K03329  amino acid exporter
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW0320 (yahN)
Transporters [BR:ecj02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   JW0320 (yahN)
Motif
Pfam: LysE TerC
Other DBs
NCBI-ProteinID: BAE76111
UniProt: P75693
Position
complement(344890..345561)
AA seq 223 aa
MMQLVHLFMDEITMDPLHAVYLTVGLFVITFFNPGANLFVVVQTSLASGRRAGVLTGLGV
ALGDAFYSGLGLFGLATLITQCEEIFSLIRIVGGAYLLWFAWCSMRRQSTPQMSTLQQPI
SAPWYVFFRRGLITDLSNPQTVLFFISIFSVTLNAETPTWARLMAWAGIVLASIIWRVFL
SQAFSLPAVRRAYGRMQRVASRVIGAIIGVFALRLIYEGVTQR
NT seq 672 nt   +upstreamnt  +downstreamnt
atgatgcagttagttcacttatttatggatgaaatcactatggatcctttgcatgccgtt
tacctgaccgtaggactgttcgtgattactttttttaatccgggagccaatctctttgtg
gtagtacaaaccagcctggcttccggtcgacgcgcaggggtgctgaccgggctgggcgtg
gcgctgggcgatgcattttattccgggttgggtttgtttggtcttgcaacgctaattacg
cagtgtgaggagattttttcgcttatcagaatcgtcggcggcgcttatctcttatggttt
gcgtggtgcagcatgcgccgccagtcaacaccgcaaatgagcacactacaacaaccgatt
agcgccccctggtatgtcttttttcgccgcggattaattaccgatctctctaacccgcaa
accgttttattttttatcagtattttctcagtaacattaaatgccgaaacaccaacatgg
gcacgtttaatggcctgggcggggattgtgctcgcatcaattatctggcgagtttttctt
agtcaggcgttttctttgcccgctgtgcgtcgtgcttatgggcgtatgcaacgcgttgcc
agtcgggttattggtgcaattattggtgtattcgcgctacgcctgatttacgaaggggtg
acgcagcggtga

DBGET integrated database retrieval system