KEGG   Escherichia coli K-12 W3110: JW0337
Entry
JW0337            CDS       T00068                                 

Gene name
mhpR
Definition
(GenBank) DNA-binding transcriptional activator, 3HPP-binding
  KO
K05818  IclR family transcriptional regulator, mhp operon transcriptional activator
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ecj03000]
    JW0337 (mhpR)
Transcription factors [BR:ecj03000]
 Prokaryotic type
  Helix-turn-helix
   IclR family
    JW0337 (mhpR)
SSDB
Motif
Pfam: HTH_IclR IclR MarR_2 HTH_24 MarR GAF GAF_2 HTH_Crp_2 HTH_11 HTH_36 HTH_29 TrmB HTH_28 GAF_3 GntR HTH_DeoR HTH_23 HTH_5 Rrf2 HTH_20
Other DBs
NCBI-ProteinID: BAE76128
UniProt: P77569
Position
complement(366811..367758)
AA seq 315 aa
MIFYCALSIGRVFSATIKTCPNVHQVHHVVLTIEMSINMQNNEQTEYKTVRGLTRGLMLL
NMLNKLDGGASVGLLAELSGLHRTTVRRLLETLQEEGYVRRSPSDDSFRLTIKVRQLSEG
FRDEQWISALAAPLLGDLLREVVWPTDVSTLDVDAMVVRETTHRFSRLSFHRAMVGRRLP
LLKTASGLTWLAFCPEQDRKELIEMLASRPGDDYQLAREPLKLEAILARARKEGYGQNYR
GWDQEEKIASIAVPLRSEQRVIGCLNLVYMASAMTIEQAAEKHLPALQRVAKQIEEGVES
QAILVAGRRSGMHLR
NT seq 948 nt   +upstreamnt  +downstreamnt
atgattttttattgtgcgctcagtataggaagggtgttttcggctacaatcaaaacatgc
ccgaatgtgcaccaggtgcaccacgttgttttaactatagaaatgtcaattaatatgcag
aacaatgagcagacggaatacaaaaccgtgcgcggcttaacccgcggtctaatgttatta
aatatgttaaataaacttgatggcggtgccagcgtcgggctgctggcggaactcagcggc
ctgcatcgcaccactgtgcggcgactgctggagacgctgcaggaagagggatatgtccgc
cgtagcccctccgatgatagttttcgactgaccatcaaagtgcggcaattaagcgaagga
tttcgtgacgaacagtggatttctgcactggcggccccactgctgggcgatctgttgcgc
gaagtggtatggccgacagatgtgtccacgctggatgttgatgcaatggtggtacgcgaa
accactcaccgtttcagccgcttatcctttcaccgggcaatggtcgggcgacgtttgccg
cttctgaaaaccgcctcgggcctgacctggctggccttttgcccggaacaagaccgcaag
gaattaatcgaaatgttagcctcccgccccggtgatgactatcaactggcacgggaaccg
ttaaagctggaagccattctggcgcgcgcgcgcaaagagggttacggacagaactaccgc
ggctgggatcaggaggagaagatcgcctctatcgccgtaccgctgcgcagtgaacaacgg
gtgattggctgtctgaatctggtgtatatggcgagcgcaatgaccattgaacaggcagcg
gaaaagcatcttccggcgctacaacgggtagcaaaacagatcgaagaaggggttgaatcg
caggctattctggtggccggaaggcgaagcggcatgcatttacgttga

DBGET integrated database retrieval system