KEGG   Escherichia coli K-12 W3110: JW0345
Entry
JW0345            CDS       T00068                                 

Gene name
yaiL
Definition
(GenBank) nucleoprotein/polynucleotide-associated enzyme
  KO
K09912  uncharacterized protein
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    JW0345 (yaiL)
SSDB
Motif
Pfam: DUF2058 Dynactin_p62
Other DBs
NCBI-ProteinID: BAE76136
UniProt: P51024
Position
375996..376535
AA seq 179 aa
MAKLTLQEQLLKAGLVTSKKAAKVERTAKKSRVQAREARAAVEENKKAQLERDKQLSEQQ
KQAALAKEYKAQVKQLIEMNRITIANGDIGFNFTDGNLIKKIFVDKLTQAQLINGRLAIA
RLLVDNNSEGEYAIIPASVADKIAQRDASSIVLHSALSAEEQDEDDPYADFKVPDDLMW
NT seq 540 nt   +upstreamnt  +downstreamnt
atggcaaaacttaccttacaagagcagttgctcaaagcaggattagtcaccagcaaaaaa
gcggcgaaggtggagagaacggcgaaaaaatcgcgcgttcaggcgcgtgaagctcgggcg
gcggtagaagaaaataaaaaggcacagcttgagcgtgataaacagcttagcgaacagcaa
aaacaagcggcgttggcgaaagaatataaagctcaggtgaagcagcttattgaaatgaac
cgaatcaccattgccaatggcgatattggttttaacttcactgacggcaatctgattaag
aagatttttgtcgataagctcacacaggcgcagttgattaatggtcgtctggcgattgcc
cgcttgttggtcgataacaatagcgaaggtgaatacgccattattcccgccagcgttgcc
gataaaattgctcagcgcgatgccagcagtatagtgttgcacagcgcgctcagcgccgaa
gagcaggatgaagacgacccgtatgccgacttcaaagtgcctgatgatttgatgtggtaa

DBGET integrated database retrieval system