KEGG   Escherichia coli K-12 W3110: JW0400Help
Entry
JW0400            CDS       T00068                                 

Gene name
yajD
Definition
(GenBank) conserved hypothetical protein
Organism
ecj  Escherichia coli K-12 W3110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HNH
Motif
Other DBs
NCBI-ProteinID: BAE76190
UniProt: P0AAQ2
Position
429829..430176
Genome map
AA seq 115 aa AA seqDB search
MAIIPKNYARLESGYREKALKIYPWVCGRCSREFVYSNLRELTVHHIDHDHTNNPEDGSN
WELLCLYCHDHEHSKYTEADQYGTTVIAGEDAQKDVGEAKYNPFADLKAMMNKKK
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggctatcatcccaaaaaactatgcgcggttagaaagcggctatcgcgaaaaagcatta
aaaatctatccgtgggtctgcggtcgctgttcccgcgagtttgtttattccaacctgcgt
gaacttaccgttcaccacattgatcacgaccataccaataacccggaagatggcagtaac
tgggaattgttgtgtctctattgccacgatcatgagcattcgaaatataccgaagcggat
cagtatggtacgaccgttatcgcaggggaagatgcgcagaaagatgtcggtgaagcgaag
tacaacccattcgctgacctgaaagcgatgatgaacaagaagaagtga

DBGET integrated database retrieval system