KEGG   Escherichia coli K-12 W3110: JW0415Help
Entry
JW0415            CDS       T00068                                 

Gene name
panE
Definition
(GenBank) 2-dehydropantoate reductase, NADPH-specific
  KO
K00077  2-dehydropantoate 2-reductase [EC:1.1.1.169]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj00770  Pantothenate and CoA biosynthesis
ecj01100  Metabolic pathways
ecj01110  Biosynthesis of secondary metabolites
Module
ecj_M00119  Pantothenate biosynthesis, valine/L-aspartate => pantothenate
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    JW0415 (panE)
Enzymes [BR:ecj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.169  2-dehydropantoate 2-reductase
     JW0415 (panE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ApbA_C ApbA Rossmann-like NAD_Gly3P_dh_N ATP-cone F420_oxidored HbrB NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: BAE76205
UniProt: P0A9J4
Structure
PDB: 

Position
complement(442828..443739)
Genome map
AA seq 303 aa AA seqDB search
MKITVLGCGALGQLWLTALCKQGHEVQGWLRVPQPYCSVNLVETDGSIFNESLTANDPDF
LATSDLLLVTLKAWQVSDAVKSLASTLPVTTPILLIHNGMGTIEELQNIQQPLLMGTTTH
AARRDGNVIIHVANGITHIGPARQQDGDYSYLADILQTVLPDVAWHNNIRAELWRKLAVN
CVINPLTAIWNCPNGELRHHPQEIMQICEEVAAVIEREGHHTSAEDLRDYVMQVIDATAE
NISSMLQDIRALRHTEIDYINGFLLRRARAHGIAVPENTRLFEMVKRKESEYERIGTGLP
RPW
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattaccgtattgggatgcggtgccttagggcaattatggcttacagcactttgc
aaacagggtcatgaagttcagggctggctgcgcgtaccgcaaccttattgtagcgtgaat
ctggttgagacagatggttcgatatttaacgaatcgctgaccgccaacgatcccgatttt
ctcgccaccagcgatctgctcctggtgacgctgaaagcatggcaggtttccgatgccgtc
aaaagcctcgcgtccacactgcctgtaactacgccaatactgttaattcacaacggcatg
ggcaccatcgaagagttgcaaaacattcagcagccattactgatgggcaccaccacccat
gcagcccgccgcgacggcaatgtcattattcatgtggcaaacggtatcacgcatattggc
ccggcacggcaacaggacggggattacagttatctggcggatattttgcaaaccgtgttg
cctgacgttgcctggcataacaatattcgcgccgagctgtggcgcaagctggcagtcaac
tgcgtgattaatccactgactgccatctggaattgcccgaacggtgaattacgtcatcat
ccgcaagaaattatgcagatatgcgaagaagtcgcggcggtgatcgaacgcgaagggcat
catacttcagcagaagatttgcgtgattacgtgatgcaggtgattgatgccacagcggaa
aatatctcgtcgatgttgcaggatatccgcgcgctgcgccacactgaaatcgactatatc
aatggttttctcttacgccgcgcccgcgcgcatgggattgccgtaccggaaaacacccgc
ctgtttgaaatggtaaaaagaaaggagagtgaatatgagcgcatcggcactggtttgcct
cgcccctggtag

DBGET integrated database retrieval system