KEGG   Escherichia coli K-12 W3110: JW0435Help
Entry
JW0435            CDS       T00068                                 

Gene name
ybaE
Definition
(GenBank) predicted transporter subunit
Organism
ecj  Escherichia coli K-12 W3110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SgrR_N SBP_bac_5 HTH_28 MarR_2 Rrf2 HTH_29 HTH_36 DHC_N2
Motif
Other DBs
NCBI-ProteinID: BAE76225
UniProt: P46890
Position
complement(464836..466536)
Genome map
AA seq 566 aa AA seqDB search
MRLLNRLNQYQRLWQPSAGKPQTVTVSELAERCFCSERHVRTLLRQAQEAGWLEWQAQSG
RGKRGQLRFLVTPESLRNAMMEQALETGKQQDVLELAQLAPGELRTLLQPFMGGQWQNDT
PTLRIPYYRPLEPLQPGFLPGRAEQHLAGQIFSGLTRFDNNTQRPIGDLAHHWETSTDGL
RWDFYLRSTLHWHNGDAVKASHLHQRLLMLLQLPALDQLFISVKRIEVTHPQCLTFFLHR
PDYWLAHRLASYCSHLAHPQFPLIGTGPFRLTQFTAELVRLESHDYYHLRHPLLKAVEYW
ITPPLFEKDLGTSCRHPVQITIGKPEELQRVSQVSSGISLGFCYLTLRKSPRLSLWQARK
VISIIHQSGLLQTLEVGENLITASHALLPGWTIPHWQVPDEVKLPKTLTLVYHLPIELHT
MAERLQATLAAEGCELTIIFHNAKNWDDTTLQAHADLMMGDRLIGEAPEYTLEQWLRCDP
LWPHVFDAPAYAHLQSTLDAVQIMPDEENRFNALKAVFSQLMTDATLTPLFNYHYRISAP
PGVNGVRLTPRGWFEFTEAWLPAPSQ
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgcgattgctcaaccgtcttaaccagtatcaacgtctgtggcaaccttccgccggaaag
ccgcaaaccgtcaccgtcagcgaactggccgaacgctgtttttgcagcgaacgccatgtt
cgtacgctgttgcgtcaggcacaggaggcgggatggctggagtggcaggcgcagtcagga
cgcggaaagcgcggacaattacgctttctggtcacgccggaatcgctacgcaatgcgatg
atggaacaggcactggaaaccggaaagcagcaagatgtgctggagctggcgcaactggcc
ccaggtgagctgcgcactctgttacagccgtttatgggcggacaatggcaaaacgataca
cccacgttgcgtattccctactatcgcccgctcgaaccgctacaaccaggctttttgccc
ggccgtgccgagcagcatctcgccgggcagatattttccggcctgacccgcttcgataat
aatactcagcgcccgattggcgatttagcgcatcactgggaaacctctactgacgggtta
cgctgggacttttatcttcgttcaaccctacactggcataacggcgatgcagtaaaagcc
tcacacttacaccagcgattattgatgctgttacaactgccagcactggatcaattattt
attagcgtgaagcgtattgaagtcacccatccgcagtgtctgaccttctttttacatcgc
cctgattactggcttgcgcaccggctggcgagctattgcagccatctggcgcatccgcaa
ttcccactgatcggcacgggtccttttcgcttaacacaattcacagcagagctggtgcgc
ctggaaagccatgattattaccatttacgtcatccgctgcttaaagcggttgagtactgg
ataactccgccgcttttcgaaaaagatttgggaaccagttgtcggcatcccgtgcaaatc
accatcggcaaaccggaggagctgcaacgggtcagccaggtcagtagcggcatcagttta
ggtttttgctatttgacgttgcgcaaaagtccccgactctccctctggcaggcgcgaaaa
gtgatctccattattcatcaatccggtttattacaaacgttagaagtcggagaaaacctg
atcaccgccagtcatgcattactgccaggctggactattccgcattggcaggtaccggat
gaagtcaaactaccgaaaaccttgacgctggtttatcacctaccgatagaacttcatacc
atggcagaacgcctacaggcgacactggcagcggaaggctgtgaactcacaattattttt
cataacgcaaaaaactgggacgacacgaccctacaggcacacgcagacctcatgatgggc
gacagattaattggcgaagcaccggaatatactctggagcaatggctgcgctgcgatccg
ctgtggccacatgttttcgacgctccagcatacgcacatctacaatcgacactggatgcc
gtgcaaataatgcctgatgaagaaaaccgatttaatgccctgaaagcggtttttagccag
ttaatgacagatgcgacgctgacgccgctgttcaactatcactatcgcattagtgcccct
cccggcgtgaacggtgtgcgactgacaccgcgcggctggtttgaatttaccgaagcctgg
cttcccgcgccatcgcaatga

DBGET integrated database retrieval system