KEGG   Escherichia coli K-12 W3110: JW0441Help
Entry
JW0441            CDS       T00068                                 

Gene name
amtB
Definition
(GenBank) ammonium transporter
  KO
K03320  ammonium transporter, Amt family
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW0441 (amtB)
Transporters [BR:ecj02000]
 Other Transporters
  Pores ion channels [TC:1]
   JW0441 (amtB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ammonium_transp
Motif
Other DBs
NCBI-ProteinID: BAE76231
UniProt: P69681
Structure
PDB: 

Position
472190..473476
Genome map
AA seq 428 aa AA seqDB search
MKIATIKTGLASLAMLPGLVMAAPAVADKADNAFMMICTALVLFMTIPGIALFYGGLIRG
KNVLSMLTQVTVTFALVCILWVVYGYSLAFGEGNNFFGNINWLMLKNIELTAVMGSIYQY
IHVAFQGSFACITVGLIVGALAERIRFSAVLIFVVVWLTLSYIPIAHMVWGGGLLASHGA
LDFAGGTVVHINAAIAGLVGAYLIGKRVGFGKEAFKPHNLPMVFTGTAILYIGWFGFNAG
SAGTANEIAALAFVNTVVATAAAILGWIFGEWALRGKPSLLGACSGAIAGLVGVTPACGY
IGVGGALIIGVVAGLAGLWGVTMLKRLLRVDDPCDVFGVHGVCGIVGCIMTGIFAASSLG
GVGFAEGVTMGHQLLVQLESIAITIVWSGVVAFIGYKLADLTVGLRVPEEQEREGLDVNS
HGENAYNA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaagatagcgacgataaaaactgggcttgcttcactggcgatgcttccgggactggta
atggctgcacctgcggtggccgataaagccgacaatgcgtttatgatgatttgtactgcg
ctggtgctgtttatgactattccggggattgccctgttttacggtgggttgattcgcggc
aaaaacgtgctgtcgatgctgacgcaggtgacggtgacatttgcactggtctgtattctc
tgggtggtttacggttactcgctggcgtttggtgagggcaacaacttcttcggcaacatt
aactggttgatgctgaaaaacatcgaactgacggcggtgatgggcagcatttatcagtat
atccacgtggcgtttcagggatcgtttgcctgcattaccgtcggcttgatagttggggcg
ctggcggaacgaatccgcttctcagctgtgttgattttcgtggtggtatggctgacgctc
tcttacattccgattgcgcatatggtgtggggcggtggtttgctggcttctcacggtgcg
ctggatttcgcgggtggcaccgtggtgcacattaacgccgcaatcgccggtctggtgggc
gcgtatctgataggaaaacgcgtgggcttcggtaaagaggcgtttaaaccgcacaacctg
ccgatggtcttcaccgggactgccattctctatatcggttggtttggctttaacgccggg
tcagcgggcacggcgaatgaaatcgcggcactggcatttgtgaatactgtggtcgcaacg
gcggcggcaattcttggctggatcttcggtgaatgggcgctgcgtggtaagccttcactg
ctgggggcgtgttctggcgcgattgccggtctggtcggcgtgacgccagcctgcggctac
attggggttggcggcgcgttgattatcggcgtggtagctggtctggcgggcttgtggggc
gttaccatgctcaaacgcttgctgcgggtggatgatccctgcgatgtcttcggtgtgcac
ggcgtttgtggcattgtcggctgtatcatgaccgggatttttgccgccagctcgctgggc
ggcgtgggcttcgctgaaggtgtgacgatgggccatcagttgctggtacagctggaaagc
atcgccattacgatcgtctggtccggtgttgtggcatttatcggctacaaattggcggat
ctgacggttggtctgcgtgtaccggaagagcaggagcgagaagggctggatgtcaacagc
cacggcgagaatgcctataacgcgtaa

DBGET integrated database retrieval system