KEGG   Escherichia coli K-12 W3110: JW0458Help
Entry
JW0458            CDS       T00068                                 

Gene name
apt
Definition
(GenBank) adenine phosphoribosyltransferase
  KO
K00759  adenine phosphoribosyltransferase [EC:2.4.2.7]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj00230  Purine metabolism
ecj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    JW0458 (apt)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecj04147]
    JW0458 (apt)
Enzymes [BR:ecj01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.7  adenine phosphoribosyltransferase
     JW0458 (apt)
Exosome [BR:ecj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   JW0458 (apt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pribosyltran UPRTase PRTase_2
Motif
Other DBs
NCBI-ProteinID: BAE76248
UniProt: P69503
Structure
PDB: 

Position
490636..491187
Genome map
AA seq 183 aa AA seqDB search
MTATAQQLEYLKNSIKSIQDYPKPGILFRDVTSLLEDPKAYALSIDLLVERYKNAGITKV
VGTEARGFLFGAPVALGLGVGFVPVRKPGKLPRETISETYDLEYGTDQLEIHVDAIKPGD
KVLVVDDLLATGGTIEATVKLIRRLGGEVADAAFIINLFDLGGEQRLEKQGITSYSLVPF
PGH
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgactgcacagcagcttgagtatctcaaaaatagcatcaaaagcattcaggac
tacccaaaacccggcattcttttccgcgatgtcaccagcttactggaagacccgaaagct
tacgctctcagcatcgacttgctggttgagcgttacaaaaatgcgggcattaccaaagtt
gtcggcaccgaagcgcgtggcttcttgtttggcgctccggtagctctgggtctgggcgtt
ggctttgtaccggtccgtaaaccgggcaaactgccgcgtgaaaccatcagtgaaacttac
gacctggaatacggcaccgatcagctggagatccacgttgatgccatcaaaccgggcgac
aaagttctggtggtggacgacctgctggcaaccggcggcactatcgaagcgaccgttaaa
ctgatccgtcgtctgggtggtgaagtggctgacgctgcgttcattatcaacctgttcgat
ctcggcggcgaacagcgtctcgaaaaacagggcattaccagctacagccttgtcccgttc
ccgggccattaa

DBGET integrated database retrieval system