KEGG   Escherichia coli K-12 W3110: JW0610Help
Entry
JW0610            CDS       T00068                                 

Gene name
citC
Definition
(GenBank) citrate lyase synthetase
  KO
K01910  [citrate (pro-3S)-lyase] ligase [EC:6.2.1.22]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    JW0610 (citC)
Enzymes [BR:ecj01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.22  [citrate (pro-3S)-lyase] ligase
     JW0610 (citC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Citrate_ly_lig HIGH_NTase1 Acetyltransf_10 Acetyltransf_1 FR47 CENP-F_C_Rb_bdg
Motif
Other DBs
NCBI-ProteinID: BAA35254
UniProt: P77390
Position
complement(650021..651079)
Genome map
AA seq 352 aa AA seqDB search
MFGNDIFTRVKRSENKKMAEIAQFLHENDLSVDTTVEVFITVTRDEKLIACGGIAGNIIK
CVAISESVRGEGLALTLATELINLAYERHSTHLFIYTKTEYEALFRQCGFSTLTSVPGVM
VLMENSATRLKRYAESLKKFRHPGNKIGCIVMNANPFTNGHRYLIQQAAAQCDWLHLFLV
KEDSSRFPYEDRLDLVLKGTADIPRLTVHRGSEYIISRATFPCYFIKEQSVINHCYTEID
LKIFRQYLAPALGVTHRFVGTEPFCRVTAQYNQDMRYWLETPTISAPPIELVEIERLRYQ
EMPISASRVRQLLAKNDLTAIAPLVPAVTLHYLQNLLEHSRQDAAARQKTPA
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgttcggcaatgatattttcacccgcgtaaaacgttcagaaaataaaaaaatggcggaa
atcgcccaattcctgcatgaaaatgatttgagcgttgacaccacagtcgaagtatttatt
accgtaacccgcgatgaaaagcttatcgcgtgcggtggaattgccggaaatattattaaa
tgcgttgctatcagtgaatccgtccgcggtgaaggactggcgctgacattagccactgaa
ttgataaacctcgcctatgagcggcacagcacgcatctgtttatttataccaaaaccgaa
tacgaggcgctgttccgccagtgcggtttttccacgctgaccagcgtacccggcgtgatg
gtgctgatggaaaacagcgccacgcgactgaaacgctatgccgaatcgctgaaaaaattt
cgtcatccagggaacaagattggctgcattgtgatgaacgccaatccctttacgaatggt
caccgttatctgattcaacaggctgcggcacagtgcgactggttgcatctgtttttagtc
aaagaagattcttcacgcttcccctatgaagaccggctggatttggtgttaaaaggcacc
gccgatattccacgcctgactgtgcatcgtggctccgaatacatcatctcccgcgctacg
ttcccttgctacttcattaaagaacagagcgtcattaaccattgttacaccgaaattgat
ctgaagattttccgtcagtacctcgctcccgcgctgggtgtaactcaccgctttgtcggt
actgaacccttttgtcgcgttaccgcccagtacaaccaggatatgcgctactggctggaa
acgccgactatctccgcaccgcccatcgaactggttgaaattgagcggctgcgttaccag
gagatgccgatatccgcttcccgggtacgtcaactgctggcgaaaaacgatctcacggct
atcgcgccgctggtccctgcagtcacgctgcattatttgcagaacctgcttgagcactcc
cgccaggacgcggcagctcgtcaaaagacccccgcatga

DBGET integrated database retrieval system