KEGG   Escherichia coli K-12 W3110: JW0628Help
Entry
JW0628            CDS       T00068                                 

Gene name
rlpA
Definition
(GenBank) minor lipoprotein
  KO
K03642  rare lipoprotein A
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    JW0628 (rlpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DPBB_1 SPOR
Motif
Other DBs
NCBI-ProteinID: BAA35276
UniProt: P10100
Position
complement(664524..665612)
Genome map
AA seq 362 aa AA seqDB search
MRKQWLGICIAAGMLAACTSDDGQQQTVSVPQPAVCNGPIVEISGADPRFEPLNATANQD
YQRDGKSYKIVQDPSRFSQAGLAAIYDAEPGSNLTASGEAFDPTQLTAAHPTLPIPSYAR
ITNLANGRMIVVRINDRGPYGNDRVISLSRAAADRLNTSNNTKVRIDPIIVAQDGSLSGP
GMACTTVAKQTYALPAPPDLSGGAGTSSVSGPQGDILPVSNSTLKSEDPTGAPVTSSGFL
GAPTTLAPGVLEGSEPTPAPQPVVTAPSTTPATSPAMVTPQAVSQSASGNFMVQVGAVSD
QARAQQYQQQLGQKFGVPGRVTQNGAVWRIQLGPFASKAEASTLQQRLQTEAQLQSFITT
AQ
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaagcagtggctcgggatctgcatcgcggcaggaatgctcgcggcatgtacaagc
gatgatggtcagcaacagacggtaagtgtaccgcagcctgcggtatgtaacggccctata
gttgaaattagcggggcggacccgcgtttcgaaccactgaacgcgacggcaaatcaggat
taccagcgcgacggtaaaagctacaaaatcgtgcaggatccgtctcgatttagccaggcg
ggactggcggcaatctatgatgccgaacccggcagtaacctgacggcctctggcgaagca
ttcgatccgacacagctgacggcagcccatccaacgcttccgatccccagctacgccaga
atcactaacctggctaacgggcgaatgatcgtggtgcgcattaatgatcgcggcccttac
ggcaacgaccgcgttatttcactttctcgcgcggcagctgaccgtcttaacacgtcaaac
aacaccaaagttcgtatcgatccgattattgttgcccaggatggttcgctttctggtcct
ggtatggcttgtaccacagtcgccaaacagacttacgccctgcctgcacctcccgattta
agcggtggcgcgggaacaagttcagtgtctggcccgcagggtgacattcttccggtcagt
aattcgacgctaaaaagcgaagatccgaccggcgcgccggtaaccagtagcggtttcctc
ggcgcaccaacgaccttagcgcctggtgtactggaaggcagcgaaccgacgcctgcgcca
cagcccgttgttacagctccgtcgacaacgcctgcaacctcgcctgcaatggtgacaccg
caagccgtctcgcaaagcgccagcggcaactttatggtgcaagtcggggccgtaagcgat
caggctcgtgcgcaacagtaccaacagcaactgggacagaagttcggcgtccccggtcgc
gtaactcaaaatggcgcggtctggcggatccagcttggcccattcgccagcaaagccgaa
gccagtaccttgcagcaacgtttgcaaaccgaagcccaattacagtcatttattactacc
gcgcagtag

DBGET integrated database retrieval system