KEGG   Escherichia coli K-12 W3110: JW0638
Entry
JW0638            CDS       T00068                                 

Gene name
ybeL
Definition
(GenBank) conserved hypothetical protein
Organism
ecj  Escherichia coli K-12 W3110
SSDB
Motif
Pfam: DUF1451 TniQ Apolipoprotein VbhA DUF4709 Herpes_UL92 Zn-ribbon_8
Other DBs
NCBI-ProteinID: BAA35290
UniProt: P0AAT9
Position
675440..675922
AA seq 160 aa
MNKVAQYYRELVASLSERLRNGERDIDALVEQARERVIKTGELTRTEVDELTRAVRRDLE
EFAMSYEESLKEESDSVFMRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVV
GLGNLVCEKCHFHLPIYTPEVLTLCPKCGHDQFQRRPFEP
NT seq 483 nt   +upstreamnt  +downstreamnt
atgaacaaggttgctcaatattaccgtgaactggttgcgtcactgagcgaacgcctgcgc
aatggcgaacgtgatatcgacgcactggtggaacaggcgcgcgagcgcgtaataaaaaca
ggggagttaacgcgaaccgaggtcgatgagctgacgcgagctgtcagacgtgacctggaa
gagttcgccatgagctatgaagagagcctgaaagaagaatctgacagcgtctttatgcgg
gtgattaaagaaagcttgtggcaggagctggcagacatcaccgataaaacgcagcttgaa
tggcgcgaagttttccaggacctcaatcatcatggggtttatcacagcggagaagtggtc
gggctgggaaatctggtctgcgagaaatgtcacttccatctcccgatctacacaccggaa
gtgctgacgctatgcccgaaatgtggtcatgaccagttccagagacgcccgtttgagccg
taa

DBGET integrated database retrieval system