KEGG   Escherichia coli K-12 W3110: JW0671Help
Entry
JW0671            CDS       T00068                                 

Gene name
fldA
Definition
(GenBank) flavodoxin 1
  KO
K03839  flavodoxin I
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    JW0671 (fldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavodoxin_1 Flavodoxin_3 Flavodoxin_5 Flavodoxin_4
Motif
Other DBs
NCBI-ProteinID: BAA35333
UniProt: P61949
Structure
PDB: 

Position
complement(711357..711887)
Genome map
AA seq 176 aa AA seqDB search
MAITGIFFGSDTGNTENIAKMIQKQLGKDVADVHDIAKSSKEDLEAYDILLLGIPTWYYG
EAQCDWDDFFPTLEEIDFNGKLVALFGCGDQEDYAEYFCDALGTIRDIIEPRGATIVGHW
PTAGYHFEASKGLADDDHFVGLAIDEDRQPELTAERVEKWVKQISEELHLDEILNA
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atggctatcactggcatctttttcggcagcgacaccggtaataccgaaaatatcgcaaaa
atgattcaaaaacagcttggtaaagacgttgccgatgtccatgacattgcaaaaagcagc
aaagaagatctggaagcttatgacattctgctgctgggcatcccaacctggtattacggc
gaagcgcagtgtgactgggatgacttcttcccgactctcgaagagattgatttcaacggc
aaactggttgcgctgtttggttgtggtgaccaggaagattacgccgaatatttctgcgac
gcattgggcaccatccgcgacatcattgaaccgcgcggtgcaaccatcgttggtcactgg
ccaactgcgggctatcatttcgaagcatcaaaaggtctggcagatgacgaccactttgtc
ggtctggctatcgacgaagaccgtcagccggaactgaccgctgaacgtgtagaaaaatgg
gttaaacagatttctgaagagttgcatctcgacgaaattctcaatgcctga

DBGET integrated database retrieval system