KEGG   Escherichia coli K-12 W3110: JW0683Help
Entry
JW0683            CDS       T00068                                 

Gene name
kdpD
Definition
(GenBank) fused sensory histidine kinase in two-component regulatory system with KdpE
  KO
K07646  two-component system, OmpR family, sensor histidine kinase KdpD [EC:2.7.13.3]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    JW0683 (kdpD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ecj01001]
    JW0683 (kdpD)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ecj02022]
    JW0683 (kdpD)
Enzymes [BR:ecj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     JW0683 (kdpD)
Protein kinases [BR:ecj01001]
 Histidine kinases
  OmpR family
   JW0683 (kdpD)
Two-component system [BR:ecj02022]
 OmpR family
  KdpD-KdpE (potassium transport)
   JW0683 (kdpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: KdpD DUF4118 HATPase_c HisKA GAF_3 HATPase_c_2 Usp
Motif
Other DBs
NCBI-ProteinID: BAA35352
UniProt: P21865
Structure
PDB: 

Position
complement(722152..724836)
Genome map
AA seq 894 aa AA seqDB search
MNNEPLRPDPDRLLEQTAAPHRGKLKVFFGACAGVGKTWAMLAEAQRLRAQGLDIVVGVV
ETHGRKDTAAMLEGLAVLPLKRQAYRGRHISEFDLDAALARRPALILMDELAHSNAPGSR
HPKRWQDIEELLEAGIDVFTTVNVQHLESLNDVVSGVTGIQVRETVPDPFFDAADDVVLV
DLPPDDLRQRLKEGKVYIAGQAERAIEHFFRKGNLIALRELALRRTADRVDEQMRAWRGH
PGEEKVWHTRDAILLCIGHNTGSEKLVRAAARLASRLGSVWHAVYVETPALHRLPEKKRR
AILSALRLAQELGAETATLSDPAEEKAVVRYAREHNLGKIILGRPASRRWWRRETFADRL
ARIAPDLDQVLVALDEPPARTINNAPDNRSFKDKWRVQIQGCVVAAALCAVITLIAMQWL
MAFDAANLVMLYLLGVVVVALFYGRWPSVVATVINVVSFDLFFIAPRGTLAVSDVQYLLT
FAVMLTVGLVIGNLTAGVRYQARVARYREQRTRHLYEMSKALAVGRSPQDIAATSEQFIA
STFHARSQVLLPDDNGKLQPLTHPQGMTPWDDAIAQWSFDKGLPAGAGTDTLPGVPYQIL
PLKSGEKTYGLVVVEPGNLRQLMIPEQQRLLETFTLLVANALERLTLTASEEQARMASER
EQIRNALLAALSHDLRTPLTVLFGQAEILTLDLASEGSPHARQASEIRQHVLNTTRLVNN
LLDMARIQSGGFNLKKEWLTLEEVVGSALQMLEPGLSSPINLSLPEPLTLIHVDGPLFER
VLINLLENAVKYAGAQAEIGIDAHVEGENLQLDVWDNGPGLPPGQEQTIFDKFARGNKES
AVPGVGLGLAICRAIVDVHGGTITAFNRPEGGACFRVTLPQQTAPELEEFHEDM
NT seq 2685 nt NT seq  +upstreamnt  +downstreamnt
atgaataacgaacccttacgtcccgaccccgatcgtctgctggaacaaactgccgcgccg
catcgggggaagctgaaagttttcttcggtgcctgtgcaggcgtcgggaagacctgggcg
atgctggcagaagcccagcgactgcgggcgcaagggctggatattgtggttggcgtggta
gaaacccacgggcgaaaagataccgccgccatgctggaagggctggctgttctgccgtta
aaacgccaggcgtaccgtgggcggcatatcagcgagtttgatctcgatgccgccctcgcc
cgccgcccggcgctgatcttaatggacgaactggcgcacagtaatgcgccaggttcccgt
catcccaaacgctggcaggatatcgaagaactgctggaagctggcattgatgttttcact
accgtcaacgttcagcatctggaaagtctgaatgatgtggtcagcggcgtcaccggaatt
caggtacgggaaaccgtgcccgatccttttttcgatgccgccgacgacgtggtgctggtg
gacttgcccccggacgatctgcgccagcggctgaaagaaggcaaagtctatattgccggg
caggcggagcgcgccattgaacattttttccgcaaaggtaatctgatcgccctgcgcgaa
ctggcactgcgccgtactgccgatcgcgttgatgagcaaatgcgcgcctggcgggggcat
cctggcgaagagaaagtgtggcacacgcgcgacgcgatccttttatgcatcggccataac
accggcagcgaaaaactggtccgcgcagcggcgcggctggcgtcacggctgggtagcgtc
tggcacgcggtgtatgttgaaacccctgccctgcaccgcttaccggaaaaaaaacgtcgg
gcaattctcagcgccttacgtctggcgcaggaactgggcgcggagacggcaacactttct
gatccagcggaagagaaagcggtagtgcgttatgcccgtgaacataatctcggcaagatt
attctcggtcgcccggcctcgcgccgctggtggcgtcgggaaacgtttgctgaccgactg
gcgcgcatcgcccccgatctcgatcaggtgctggtcgcgcttgatgaaccacccgcccgc
acgattaacaacgcgccggataaccgctcttttaaagacaagtggcgtgtacaaattcag
ggatgcgtggttgccgccgcgttatgcgccgttatcaccttaattgccatgcagtggctg
atggcgtttgatgccgccaacctggtgatgctgtatctgcttggcgtggtggtggtggcg
ctattttatggacgctggccttcagtggttgccaccgtcattaatgtagtgagtttcgat
ctcttttttatcgccccacgcggcacgctcgccgtctctgatgtgcaatatctgctgacc
ttcgcggtgatgttaaccgtcgggctggtgatcgggaaccttactgctggcgtgcgttat
caggcgcgggtagcccgttaccgcgagcaacgcacacggcacttatatgaaatgtcgaaa
gctctggcggtgggccgcagtccgcaggatatcgctgccaccagcgaacaatttattgcc
tccacgtttcatgcccgcagtcaggtgttgttgcccgatgacaacggtaaattgcagccg
ttaacacatccgcaaggaatgacgccgtgggacgatgccatcgcgcagtggagttttgat
aaaggcctgcctgcgggcgcgggcaccgacacgttacccggtgtaccgtaccagattttg
ccgctaaaaagcggcgagaaaacctacgggctggtggtggtggagccggggaatctgcgc
cagttgatgatcccggaacagcagcgcctgctggagacgtttacgctgttagtcgccaat
gcccttgagcggctgacgctaaccgccagcgaagaacaggcgcggatggcaagcgaacgt
gaacagatccgcaacgccctgctggcggcgctttcgcatgatttacgcacgccgcttacg
gtgctgtttggtcaggcagaaatcttaacgctcgatctggcaagcgaaggatcaccccac
gcccgccaggccagcgagatccgtcagcatgtgctgaacactacccgactggtgaataat
ctactggatatggcgcgaattcagtccggcggctttaatttgaagaaagagtggttaacg
ctggaagaagtagtcggcagcgcgctgcaaatgctggaaccgggtttatcgtcgcccatc
aatctttctctgccagaaccgctgaccttaatccacgttgacgggccactctttgaacgg
gtgctgattaatctgctggagaacgcggtgaaatatgcgggtgcgcaggccgaaattggt
atcgatgcccacgttgagggcgaaaatctacaactggatgtctgggataacggccccggt
cttccgccaggccaggagcagacgatatttgataagtttgctcgcgggaataaagagtcg
gcagtaccgggggtagggcttggactggcaatttgtcgggcgatagtggatgtacacggg
ggcactattaccgcgttcaaccgaccggaaggtggtgcctgttttcgtgttacacttccc
cagcaaactgcccctgaacttgaagaatttcatgaggatatgtga

DBGET integrated database retrieval system