KEGG   Escherichia coli K-12 W3110: JW0684Help
Entry
JW0684            CDS       T00068                                 

Gene name
kdpC
Definition
(GenBank) potassium translocating ATPase, subunit C
  KO
K01548  K+-transporting ATPase ATPase C chain [EC:3.6.3.12]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    JW0684 (kdpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: KdpC
Motif
Other DBs
NCBI-ProteinID: BAA35353
UniProt: P03961
Structure
PDB: 

Position
complement(724829..725401)
Genome map
AA seq 190 aa AA seqDB search
MSGLRPALSTFIFLLLITGGVYPLLTTVLGQWWFPWQANGSLIREGDTVRGSALIGQNFT
GNGYFHGRPSATAEMPYNPQASGGSNLAVSNPELDKLIAARVAALRAANPDASASVPVEL
VTASASGLDNNITPQAAAWQIPRVAKARNLSVEQLTQLIAKYSQQPLVKYIGQPVVNIVE
LNLALDKLDE
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgagtggattacgtccggcattatcaacatttatctttctgttattgattactggcggc
gtttacccgctgctgaccaccgtactggggcaatggtggtttccctggcaggccaatggt
tcgttgattcgtgaaggtgatacggtgcgcggttcggcattaatcgggcagaattttacc
ggcaacggctattttcatggtcgcccgtcggcaacggcagaaatgccctataatccacag
gcttctggcgggagcaatctggcggtcagtaaccctgagctggataaactaatagccgca
cgcgttgctgcattacgggccgctaacccggatgccagcgcgagcgttccggttgaactg
gtgacggcatcggcaagcgggctggacaataatatcaccccgcaagcggcggcctggcaa
atcccacgcgtggcgaaagcgcgtaatctcagcgttgaacagctcacgcaactgatcgca
aaatacagccaacaaccgctggtgaaatatatcggccagccggttgtcaacattgttgaa
ctcaatctggcgctggataaacttgatgaataa

DBGET integrated database retrieval system