KEGG   Escherichia coli K-12 W3110: JW0719Help
Entry
JW0719            CDS       T00068                                 

Gene name
mngR
Definition
(GenBank) DNA-binding transcriptional dual regulator, fatty-acyl-binding
  KO
K11922  GntR family transcriptional regulator, mannosyl-D-glycerate transport/metabolism system repressor
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ecj03000]
    JW0719 (mngR)
Transcription factors [BR:ecj03000]
 Prokaryotic Type
  Helix-turn-helix
   GntR family
    JW0719 (mngR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UTRA GntR HTH_DeoR HTH_11 Rrf2 HTH_41 HTH_Crp_2 PreAtp-grasp
Motif
Other DBs
NCBI-ProteinID: BAA35396
UniProt: P13669
Position
complement(765575..766297)
Genome map
AA seq 240 aa AA seqDB search
MGHKPLYRQIADRIREQIARGELKPGDALPTESALQTEFGVSRVTVRQALRQLVEQQILE
SIQGSGTYVKEERVNYDIFQLTSFDEKLSDRHVDTHSEVLIFEVIPADDFLQQQLQITPQ
DRVWHVKRVRYRKQKPMALEETWMPLALFPDLTWQVMENSKYHFIEEVKKMVIDRSEQEI
IPLMPTEEMSRLLNISQTKPILEKVSRGYLVDGRVFEYSRNAFNTDDYKFTLIAQRKSSR
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgggacacaagcccttataccggcagattgccgatcgcattcgtgaacaaattgcgcgt
ggcgagcttaaacctggcgatgcgttacccactgaatcagcgctacaaacagagtttggc
gtcagccgggttacggtgcgtcaggctttgcgccagctagtcgagcagcagatcctcgaa
agcattcagggcagcgggacttacgtcaaagaagagcgggtcaattacgatatttttcag
ttaaccagttttgatgaaaaactgtcggaccgtcacgtcgatacacacagtgaagttctg
atattcgaagtgattccggctgacgattttcttcagcaacagctacaaatcaccccgcag
gatcgtgtgtggcatgtgaagcgcgtgcgctatcgcaagcaaaagccaatggcgctggaa
gaaacctggatgccgcttgcgttgttcccggatctcacctggcaggtcatggaaaattcg
aaatatcactttatcgaagaagtgaagaaaatggttatcgatcgtagcgaacaggaaatc
attcctctgatgccaaccgaagagatgagccgtctgcttaatatcagccagacaaagccg
attcttgaaaaagtatcgcgtggatatttagttgatggtcgggtgtttgaatatagccgc
aacgcttttaataccgatgactataaatttaccctgatagcgcagcgaaaatcatcgcga
taa

DBGET integrated database retrieval system