KEGG   Escherichia coli K-12 W3110: JW0795
Entry
JW0795            CDS       T00068                                 

Symbol
glnP
Name
(GenBank) glutamine transporter subunit
  KO
K10037  glutamine transport system permease protein
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    JW0795 (glnP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW0795 (glnP)
Transporters [BR:ecj02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Glutamine transporter
    JW0795 (glnP)
SSDB
Motif
Pfam: BPD_transp_1
Other DBs
NCBI-ProteinID: BAA35482
UniProt: P0AEQ6
Position
complement(846882..847541)
AA seq 219 aa
MQFDWSAIWPAIPLLIEGAKMTLWISVLGLAGGLVIGLLAGFARTFGGWIANHVALVFIE
VIRGTPIVVQVMFIYFALPMAFNDLRIDPFTAAVVTIMINSGAYIAEITRGAVLSIHKGF
REAGLALGLSRWETIRYVILPLALRRMLPPLGNQWIISIKDTSLFIVIGVAELTRQGQEI
IAGNFRALEIWSAVAVFYLIITLVLSFILRRLERRMKIL
NT seq 660 nt   +upstreamnt  +downstreamnt
atgcagtttgactggagtgccatctggcctgccattccgcttctgattgaaggtgccaaa
atgaccctgtggatttcggtcctcggtctggcaggcggtctggtaatcggattgctggca
ggttttgcacgcaccttcggaggttggatagccaaccacgtcgcgctggtctttattgaa
gtgatccgcggcacacctatcgtcgtccaggtgatgtttatttatttcgccctgccgatg
gcgtttaacgacttacgcatcgacccatttactgcggcggtggtcaccatcatgatcaac
tccggcgcgtatattgcggaaatcacgcgtggtgcggtgctgtctatccacaaaggtttt
cgtgaagcaggactggcgctcggtctttcacgttgggaaaccattcgctacgtcatttta
ccgctggcactgcgtcgtatgctgccgccgctgggtaaccagtggatcatcagcattaaa
gacacctcgctgtttattgtgatcggcgtggcggaactgacccgtcaggggcaagaaatt
attgccggtaacttccgcgcccttgagatctggagcgccgtggcggtgttctatctgatt
attaccctggtgctgagctttattctgcgtcgtctggaaagaaggatgaaaatcctgtga

DBGET integrated database retrieval system