KEGG   Escherichia coli K-12 W3110: JW0796
Entry
JW0796            CDS       T00068                                 

Symbol
glnH
Name
(GenBank) glutamine transporter subunit
  KO
K10036  glutamine transport system substrate-binding protein
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    JW0796 (glnH)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW0796 (glnH)
Transporters [BR:ecj02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Glutamine transporter
    JW0796 (glnH)
SSDB
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd NMT1 Phosphonate-bd
Other DBs
NCBI-ProteinID: BAA35483
UniProt: P0AEQ3
Structure
Position
complement(847680..848426)
AA seq 248 aa
MKSVLKVSLAALTLAFAVSSHAADKKLVVATDTAFVPFEFKQGDKYVGFDVDLWAAIAKE
LKLDYELKPMDFSGIIPALQTKNVDLALAGITITDERKKAIDFSDGYYKSGLLVMVKANN
NDVKSVKDLDGKVVAVKSGTGSVDYAKANIKTKDLRQFPNIDNAYMELGTNRADAVLHDT
PNILYFIKTAGNGQFKAVGDSLEAQQYGIAFPKGSDELRDKVNGALKTLRENGTYNEIYK
KWFGTEPK
NT seq 747 nt   +upstreamnt  +downstreamnt
atgaagtctgtattaaaagtttcactggctgcactgaccctggcttttgcggtttcttct
catgccgcggataaaaaattagttgtcgcgacggataccgccttcgttccgtttgaattt
aaacagggcgataaatatgtgggctttgacgttgatctgtgggctgccatcgctaaagag
ctgaagctggattacgaactgaagccgatggatttcagtgggatcattccggcactgcaa
accaaaaacgtcgatctggcgctggcgggcattaccatcaccgacgagcgtaaaaaagcg
atcgatttctctgacggctactacaaaagcggcctgttagtgatggtgaaagctaacaat
aacgatgtgaaaagcgtgaaagatctcgacgggaaagtggttgctgtgaagagcggtact
ggctccgttgattacgcgaaagcaaacatcaaaactaaagatctgcgtcagttcccgaac
atcgataacgcctatatggaactgggcaccaaccgcgcagacgccgttctgcacgatacg
ccaaacattctgtacttcatcaaaaccgccggtaacggtcagttcaaagcggtaggtgac
tctctggaagcgcagcaatacggtattgcgttcccgaaaggtagcgacgagctgcgtgac
aaagtcaacggcgcgttgaaaaccctgcgcgagaacggaacttacaacgaaatctacaaa
aaatggttcggtactgaaccgaaataa

DBGET integrated database retrieval system