KEGG   Escherichia coli K-12 W3110: JW0816
Entry
JW0816            CDS       T00068                                 

Gene name
yliD
Definition
(GenBank) predicted peptide transporter subunit
  KO
K13891  glutathione transport system permease protein
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    JW0816 (yliD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW0816 (yliD)
Transporters [BR:ecj02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Glutathione transporter
    JW0816 (yliD)
SSDB
Motif
Pfam: BPD_transp_1 OppC_N DUF3482
Other DBs
NCBI-ProteinID: BAA35527
UniProt: P75799
Position
872312..873223
AA seq 303 aa
MRLFNWRRQAVLNAMPLVKPDQVRTPWHEFWRRFRRQHMAMTAALFVILLIVVAIFARWI
APYDAENYFDYDNLNNGPSLQHWFGVDSLGRDIFSRVLVGAQISLAAGVFAVFIGAAIGT
LLGLLAGYYEGWWDRLIMRICDVLFAFPGILLAIAVVAVLGSGIANVIIAVAIFSIPAFA
RLVRGNTLVLKQQTFIESARSIGASDMTVLLRHILPGTVSSIVVFFTMRIGTSIISAASL
SFLGLGAQPPTPEWGAMLNEARADMVIAPHVAVFPALAIFLTVLAFNLLGDGLRDALDPK
IKG
NT seq 912 nt   +upstreamnt  +downstreamnt
atgcgactatttaactggcgacgtcaggcggtgttaaacgccatgccactggtcaaacct
gaccaggtacgtacaccgtggcatgaattctggcgacgatttcgccgtcagcatatggcg
atgaccgccgcattattcgttattttattgattgtggtggccatttttgcacgctggatc
gctccctatgacgccgaaaattattttgattatgacaatctgaataacggaccttctttg
cagcactggtttggcgtcgattcactggggcgtgacattttcagccgtgtcctggttggt
gcgcaaatctcgctggcggcgggcgtgtttgccgtgtttatcggtgcggcgatcgggacg
ttgctgggcttgctcgctggatattatgaaggctggtgggatcggctgatcatgcgcatt
tgcgatgtgctgtttgccttcccgggtattttactggcgatcgctgttgttgcggtgttg
ggaagcggcattgctaacgtgattattgcagtcgccattttttccatccccgcgtttgcc
cgcctggtgcgcggcaacacgctggtgttgaaacagcaaacctttattgagtcagcacgc
agtattggtgccagcgatatgaccgttttgttgcgtcatatcctgcctgggaccgtctct
tctatcgtggtgtttttcaccatgcgcattggtacctcgattatctctgccgccagcctc
tcatttctcggcctcggtgcgcagccgccgacaccagagtggggagcaatgctcaatgag
gctcgagcggatatggttatcgcgccgcatgtcgctgtttttccggccctggctattttt
ctgaccgtactggcgttcaatttgttgggcgatggtttacgcgatgcgctggatccgaaa
attaaaggatag

DBGET integrated database retrieval system