KEGG   Escherichia coli K-12 W3110: JW0847Help
Entry
JW0847            CDS       T00068                                 

Gene name
artI
Definition
(GenBank) arginine transporter subunit
  KO
K09997  arginine transport system substrate-binding protein
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    JW0847 (artI)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW0847 (artI)
Transporters [BR:ecj02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Arginine transporter
    JW0847 (artI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd Phosphonate-bd
Motif
Other DBs
NCBI-ProteinID: BAA35577
UniProt: P30859
Position
complement(902679..903410)
Genome map
AA seq 243 aa AA seqDB search
MKKVLIAALIAGFSLSATAAETIRFATEASYPPFESIDANNQIVGFDVDLAQALCKEIDA
TCTFSNQAFDSLIPSLKFRRVEAVMAGMDITPEREKQVLFTTPYYDNSALFVGQQGKYTS
VDQLKGKKVGVQNGTTHQKFIMDKHPEITTVPYDSYQNAKLDLQNGRIDGVFGDTAVVTE
WLKDNPKLAAVGDKVTDKDYFGTGLGIAVRQGNTELQQKLNTALEKVKKDGTYETIYNKW
FQK
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagttctgattgccgcgttaattgcaggttttagtctttccgccacagctgcc
gaaaccattcgttttgctaccgaagcctcctatcctccgtttgaatcgattgatgcaaac
aaccagatcgttggttttgacgtcgacctggcacaagcgctgtgtaaagagattgatgca
acctgcactttctctaaccaggcgtttgacagcctgatcccaagcctgaaattccgtcgc
gtagaagccgtgatggcgggcatggatatcactccggagcgtgaaaagcaggtgctgttt
accaccccgtactatgacaactctgccctgtttgtgggtcagcaaggcaaatacaccagt
gttgatcagctgaaaggcaaaaaagtcggcgtacagaacgggacgacacaccagaaattc
attatggataagcacccggaaatcactaccgttccgtatgacagctaccagaacgcaaaa
ctggatctgcaaaacgggcgtatcgacggcgtcttcggtgacaccgcagtggtcactgag
tggctgaaagataacccgaaactggcggcggtgggcgacaaagtgaccgataaagattac
ttcggcactggcctcggcatcgcggtacgtcagggcaacactgagctgcagcagaaactc
aacactgcgctggaaaaagtgaagaaagatggcacttacgaaaccatctacaacaaatgg
ttccagaagtaa

DBGET integrated database retrieval system