KEGG   Escherichia coli K-12 W3110: JW0878
Entry
JW0878            CDS       T00068                                 

Gene name
dmsB
Definition
(GenBank) dimethyl sulfoxide reductase, anaerobic, subunit B
  KO
K07307  anaerobic dimethyl sulfoxide reductase subunit B
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj00920  Sulfur metabolism
ecj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    JW0878 (dmsB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW0878 (dmsB)
Transporters [BR:ecj02000]
 Other transporters
  Transmembrane electron carriers [TC:5]
   JW0878 (dmsB)
SSDB
Motif
Pfam: Fer4_11 Fer4 Fer4_2 Fer4_9 Fer4_7 Fer4_6 Fer4_10 Fer4_4 Fer4_3 Fer4_21 Fer4_8 Fer4_17 Fer4_16 Fer4_13
Other DBs
NCBI-ProteinID: BAA35627
UniProt: P18776
Position
943836..944453
AA seq 205 aa
MTTQYGFFIDSSRCTGCKTCELACKDYKDLTPEVSFRRIYEYAGGDWQEDNGVWHQNVFA
YYLSISCNHCEDPACTKVCPSGAMHKREDGFVVVDEDVCIGCRYCHMACPYGAPQYNETK
GHMTKCDGCYDRVAEGKKPICVESCPLRALDFGPIDELRKKHGDLAAVAPLPRAHFTKPN
IVIKPNANSRPTGDTTGYLANPKEV
NT seq 618 nt   +upstreamnt  +downstreamnt
atgacaacccagtatggattttttattgattccagccgttgcaccggttgcaaaacctgc
gagctggcctgtaaagactacaaagatttgacgccagaagtcagcttccgccgcatttat
gaatatgctggcggcgactggcaggaagataacggtgtctggcaccagaacgtgtttgcc
tactatctgtcgatttcatgtaaccactgcgaagatccggcttgtactaaagtctgcccg
agcggtgcgatgcataaacgtgaagatggttttgttgtggtcgatgaagatgtgtgcatt
ggctgccgctactgccatatggcttgcccgtatggcgcaccgcaatataacgaaacgaaa
ggccatatgaccaaatgcgatggttgttatgaccgtgttgcggagggtaaaaagccgatc
tgtgttgaatcttgtccgctgcgggcgctggatttcggccctatcgacgagctgcgtaaa
aaacatggcgatctggcggccgttgcgccgttgccgcgagctcactttaccaaaccgaat
attgtgatcaaacccaatgccaatagccgcccgaccggggataccactggctatctggca
aacccgaaggaggtgtga

DBGET integrated database retrieval system