KEGG   Escherichia coli K-12 W3110: JW0881Help
Entry
JW0881            CDS       T00068                                 

Gene name
ycaD
Definition
(GenBank) predicted transporter
  KO
K08219  MFS transporter, UMF2 family, putative MFS family transporter protein
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW0881 (ycaD)
Transporters [BR:ecj02000]
 Major Facilitator Superfamily (MFS)
  Unknown transporters
   Unknown major facilitator-2 (UMF2) [TC:2.A.1.26]
    JW0881 (ycaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_4 Sugar_tr MFS_1_like Nterm_IS4
Motif
Other DBs
NCBI-ProteinID: BAA35630
UniProt: P21503
Position
946293..947441
Genome map
AA seq 382 aa AA seqDB search
MSTYTQPVMLLLSGLLLLTLAIAVLNTLVPLWLAQEHMSTWQVGVVSSSYFTGNLVGTLL
TGYVIKRIGFNRSYYLASFIFAAGCAGLGLMIGFWSWLAWRFVAGVGCAMIWVVVESALM
CSGTSRNRGRLLAAYMMVYYVGTFLGQLLVSKVSTELMSVLPWVTGLTLAGILPLLFTRV
LNQQAENHDSTSITSMLKLRQARLGVNGCIISGIVLGSLYGLMPLYLNHKGVSNASIGFW
MAVLVSAGILGQWPIGRLADKFGRLLVLRVQVFVVILGSIAMLSQAAMAPALFILGAAGF
TLYPVAMAWACEKVEHHQLVAMNQALLLSYTVGSLLGPSFTAMLMQNFSDNLLFIMIASV
SFIYLLMLLRNAGHTPKPVAHV
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgtccacgtatacccagcctgtcatgcttttgctgtctggcctgcttttgttgactctg
gcgattgcggtgttaaatacactcgtgccgctttggctcgcccaggaacacatgtccaca
tggcaggtaggcgttgtcagctcatcctattttaccggcaaccttgtcggtacattgctg
acagggtatgtcattaagcgcattggctttaaccgcagctattatctggcctccttcatt
tttgccgctggctgtgccggccttggcctgatgattggattctggagctggttggcttgg
cgttttgtcgcgggcgtcggctgtgccatgatttgggtggttgttgagagcgcgctgatg
tgcagtgggacgtcacgtaaccgtgggcgtttgcttgctgcgtatatgatggtttattac
gtgggaacgtttttaggccagttactggtcagcaaagtttcaaccgagctgatgtccgta
ttgccgtgggttacaggtttgacgttggcagggatcttaccgctgttgtttacgcgtgtg
ctgaatcagcaggctgaaaaccatgattcgacgtcaattacgtcaatgctaaaactccgt
caggcgcggcttggcgtgaatggctgcattatctcaggaatcgttctgggatctctatat
ggcctgatgccgctgtacctcaatcacaaaggggtgagcaatgccagcattggtttctgg
atggcggtactggtcagtgcgggtatccttggacaatggccgattggacgtctggcggat
aagtttggtcgactgctggtgttgcgtgttcaggtctttgtcgtcattctcggcagtatc
gcgatgcttagccaggcggcgatggccccagcgttattcatcctcggtgccgctggcttt
acgctatatccggtggcgatggcatgggcttgcgagaaagttgaacatcatcaactggtg
gcgatgaaccaggccttactgttgagctatactgtgggaagtctgcttggcccgtcattt
accgctatgctaatgcagaatttctccgataatttattgtttatcatgatcgccagcgta
tcgtttatctatttgctgatgctgctgcgcaacgccggtcatacgccgaaacccgttgct
cacgtgtaa

DBGET integrated database retrieval system