KEGG   Escherichia coli K-12 W3110: JW0887
Entry
JW0887            CDS       T00068                                 

Symbol
focA
Name
(GenBank) formate transporter
  KO
K06212  formate transporter
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW0887 (focA)
Transporters [BR:ecj02000]
 Other transporters
  Pores ion channels [TC:1]
   JW0887 (focA)
SSDB
Motif
Pfam: Form_Nir_trans
Other DBs
NCBI-ProteinID: BAA35639
UniProt: P0AC23
Structure
PDB: 
3KCU 3KCV

Position
complement(954031..954888)
AA seq 285 aa
MKADNPFDLLLPAAMAKVAEEAGVYKATKHPLKTFYLAITAGVFISIAFVFYITATTGTG
TMPFGMAKLVGGICFSLGLILCVVCGADLFTSTVLIVVAKASGRITWGQLAKNWLNVYFG
NLVGALLFVLLMWLSGEYMTANGQWGLNVLQTADHKVHHTFIEAVCLGILANLMVCLAVW
MSYSGRSLMDKAFIMVLPVAMFVASGFEHSIANMFMIPMGIVIRDFASPEFWTAVGSAPE
NFSHLTVMNFITDNLIPVTIGNIIGGGLLVGLTYWVIYLRENDHH
NT seq 858 nt   +upstreamnt  +downstreamnt
gtgaaagctgacaacccttttgatcttttacttcctgctgcaatggccaaagtggccgaa
gaggcgggtgtctataaagcaacgaaacatccgcttaagactttctatctggcgattacc
gccggtgttttcatctcaatcgcattcgtcttctatatcacagcaaccactggcacaggc
acaatgcccttcggcatggcaaaactggttggcggcatttgcttctctctggggctgatt
ctttgtgttgtctgcggagccgatctctttacttccaccgtgttgattgttgttgctaag
gcgagtgggcgcatcacctggggtcagttggcgaaaaactggctaaatgtctattttggc
aacctggtcggcgcactgctgtttgtacttttaatgtggctttccggcgagtatatgacc
gcaaatggtcaatggggactaaacgtcctacaaaccgccgaccacaaagtgcaccatact
tttattgaggccgtctgtcttggtatcctggcaaacctgatggtatgtctggcagtatgg
atgagttattctggccgcagcctgatggacaaagcgttcattatggtgctgccggtcgcg
atgtttgttgccagcggttttgagcacagtatcgcaaacatgtttatgatcccgatgggt
attgtaatccgcgacttcgcatccccggaattttggaccgcagtcggttctgcaccggaa
aatttttctcacctgaccgtgatgaatttcatcactgataacctgattccggttacgatc
ggcaacattatcggtggtggtttgttggttgggttgacatactgggtcatttacctgcgt
gaaaacgaccaccattaa

DBGET integrated database retrieval system