KEGG   Escherichia coli K-12 W3110: JW0913Help
Entry
JW0913            CDS       T00068                                 

Gene name
asnS
Definition
(GenBank) asparaginyl tRNA synthetase
  KO
K01893  asparaginyl-tRNA synthetase [EC:6.1.1.22]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj00970  Aminoacyl-tRNA biosynthesis
Module
ecj_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    JW0913 (asnS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ecj01007]
    JW0913 (asnS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ecj03016]
    JW0913 (asnS)
Enzymes [BR:ecj01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.22  asparagine---tRNA ligase
     JW0913 (asnS)
Amino acid related enzymes [BR:ecj01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   JW0913 (asnS)
Transfer RNA biogenesis [BR:ecj03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    JW0913 (asnS)
 Prokaryotic Type
    JW0913 (asnS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2 tRNA_anti-codon tRNA_anti_2
Motif
Other DBs
NCBI-ProteinID: BAA35682
UniProt: P0A8M0
Position
complement(988007..989407)
Genome map
AA seq 466 aa AA seqDB search
MSVVPVADVLQGRVAVDSEVTVRGWVRTRRDSKAGISFLAVYDGSCFDPVQAVINNSLPN
YNEDVLRLTTGCSVIVTGKVVASPGQGQQFEIQASKVEVAGWVEDPDTYPMAAKRHSIEY
LREVAHLRPRTNLIGAVARVRHTLAQALHRFFNEQGFFWVSTPLITASDTEGAGEMFRVS
TLDLENLPRNDQGKVDFDKDFFGKESFLTVSGQLNGETYACALSKIYTFGPTFRAENSNT
SRHLAEFWMLEPEVAFANLNDIAGLAEAMLKYVFKAVLEERADDMKFFAERVDKDAVSRL
ERFIEADFAQVDYTDAVTILENCGRKFENPVYWGVDLSSEHERYLAEEHFKAPVVVKNYP
KDIKAFYMRLNEDGKTVAAMDVLAPGIGEIIGGSQREERLDVLDERMLEMGLNKEDYWWY
RDLRRYGTVPHSGFGLGFERLIAYVTGVQNVRDVIPFPRTPRNASF
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgagcgttgtgcctgtagccgacgtactccagggccgtgtagccgttgacagcgaagtc
accgtgcgcggatgggtacgtacccgccgagattcaaaagctggcatctccttcctcgcc
gtttatgacggttcctgctttgatcctgtacaggctgtcatcaataattctctgcccaat
tacaatgaagacgtcctgcgtctgaccaccggctgctcggtcattgtgacgggtaaagtc
gtggcgtcgccgggccaggggcaacaatttgaaattcaggccagcaaggttgaagttgct
ggttgggttgaagatccagacacttacccgatggcggcaaaacgccacagcattgagtat
ctgcgtgaagtcgctcacctgcgtccgcgcacaaacctgattggtgccgtcgcgcgcgtt
cgccatacgctggcgcaggcgctgcatcgcttctttaacgagcagggattcttctgggtt
tcaacgccactgattaccgcatctgataccgaaggtgcaggcgaaatgttccgcgtttct
acgctggatctggaaaacctgccgcgtaacgatcagggcaaagtggatttcgacaaagac
ttctttggtaaagagtctttcctgaccgtatctggccagttgaacggcgaaacctacgct
tgcgcattgtccaaaatttataccttcggcccgactttccgtgctgaaaactccaacacc
agccgtcacctggcggaattctggatgctggagccggaagtggcgtttgctaacctgaac
gatattgcgggtctggctgaagccatgctgaaatatgtcttcaaagcggttctcgaagaa
cgcgctgacgacatgaaattcttcgctgaacgcgtagataaagatgccgtttcacgtctg
gaacgcttcattgaagccgattttgcgcaggtggattataccgacgcagtgaccattctc
gaaaactgcggcaggaagtttgaaaacccggtttactggggagtcgatctctcttctgag
catgagcgttatctggcggaagaacactttaaagcaccggtagtggttaaaaactatccg
aaagatattaaagcgttctatatgcgccttaacgaagacggtaaaaccgttgcggctatg
gacgttctggctccgggcatcggtgagatcattggtggctcccagcgtgaagaacgtctg
gacgtgctggacgagcgtatgctggaaatgggcctgaataaagaagattactggtggtat
cgcgatctgcgtcgctacggtactgttccgcattcaggtttcggtcttggttttgaacgt
ctgattgcttacgtaactggcgtgcaaaacgtacgtgatgtgattccgttcccacgtact
ccgcgtaacgccagcttctaa

DBGET integrated database retrieval system