KEGG   Escherichia coli K-12 W3110: JW0952Help
Entry
JW0952            CDS       T00068                                 

Gene name
yccK
Definition
(GenBank) predicted sulfite reductase subunit
  KO
K11179  tRNA 2-thiouridine synthesizing protein E [EC:2.8.1.-]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    JW0952 (yccK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ecj03016]
    JW0952 (yccK)
Enzymes [BR:ecj01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.-  
     JW0952 (yccK)
Transfer RNA biogenesis [BR:ecj03016]
 Prokaryotic type
  tRNA modification factors
   Thiolation factors
    JW0952 (yccK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DsrC Staph_opine_DH
Motif
Other DBs
NCBI-ProteinID: BAA35734
UniProt: P0AB18
Position
complement(1030761..1031090)
Genome map
AA seq 109 aa AA seqDB search
MLIFEGKEIETDTEGYLKESSQWSEPLAVVIAENEGISLSPEHWEVVRFVRDFYLEFNTS
PAIRMLVKAMANKFGEEKGNSRYLYRLFPKGPAKQATKIAGLPKPVKCI
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgctgatcttcgaaggtaaagagatagaaacggataccgaaggctatctcaaagaaagc
agccagtggagtgagccgctggctgtggtgattgcagagaacgaagggatttcgctgtca
ccggaacactgggaagtggtgcgttttgtgcgtgatttctatctggaattcaatacttct
ccggcgattcgtatgctggtaaaagcgatggcgaataaatttggcgaagaaaaaggtaac
agccgctatttataccgactgtttccgaaaggtccggctaagcaagccaccaaaattgct
ggcctgccaaaaccggtaaaatgtatttaa

DBGET integrated database retrieval system