KEGG   Escherichia coli K-12 W3110: JW0998
Entry
JW0998            CDS       T00068                                 

Gene name
ycdC
Definition
(GenBank) predicted DNA-binding transcriptional regulator
  KO
K09017  TetR/AcrR family transcriptional regulator
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ecj03000]
    JW0998 (ycdC)
Transcription factors [BR:ecj03000]
 Prokaryotic type
  Helix-turn-helix
   TetR/AcrR family
    JW0998 (ycdC)
SSDB
Motif
Pfam: TetR_C_3 TetR_N TetR_C_29
Other DBs
NCBI-ProteinID: BAA35790
UniProt: P0ACU2
Structure
PDB: 
4JYK 4XK4 4X1E 3LOC

Position
1074664..1075302
AA seq 212 aa
MTQGAVKTTGKRSRAVSAKKKAILSAALDTFSQFGFHGTRLEQIAELAGVSKTNLLYYFP
SKEALYIAVLRQILDIWLAPLKAFREDFAPLAAIKEYIRLKLEVSRDYPQASRLFCMEML
AGAPLLMDELTGDLKALIDEKSALIAGWVKSGKLAPIDPQHLIFMIWASTQHYADFAPQV
EAVTGATLRDEVFFNQTVENVQRIIIEGIRPR
NT seq 639 nt   +upstreamnt  +downstreamnt
atgacgcaaggcgcagtgaaaacaacgggtaaacgttcgcgcgcagtaagcgcgaagaaa
aaagcgattcttagcgcagcactggacactttttcacaattcggttttcacggcacaagg
ctggagcagatcgcagagttggcgggtgtttcaaaaaccaatctgctgtattactttccg
tcaaaagaggcgctgtatattgccgtgctgcggcagattctcgatatctggctggcaccg
ttaaaagcgtttcgtgaagatttcgccccgctggcggcgatcaaagagtacatccgtctg
aagctggaagtctcacgcgattatccgcaggcttcgcgcctgttctgtatggagatgctg
gcaggcgcgccgctgttaatggatgaactgacgggcgatttgaaggcattaattgatgag
aaatcggcgctgattgccggttgggtcaaaagcggcaaactcgcgccgattgatccgcag
catttgatttttatgatttgggcttccactcaacattacgccgatttcgcccctcaggtg
gaggcggtgacaggcgcgacgttgcgcgatgaggtatttttcaatcaaacggttgaaaac
gtgcagcggattattattgaggggattcgaccacgttaa

DBGET integrated database retrieval system