KEGG   Escherichia coli K-12 W3110: JW1010Help
Entry
JW1010            CDS       T00068                                 

Gene name
ycdS
Definition
(GenBank) predicted outer membrane protein
  KO
K11935  biofilm PGA synthesis protein PgaA
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj02026  Biofilm formation - Escherichia coli
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02026 Biofilm formation - Escherichia coli
    JW1010 (ycdS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPR_2 TPR_1 TPR_11
Motif
Other DBs
NCBI-ProteinID: BAA35806
UniProt: P69434
Structure
PDB: 

Position
complement(1090288..1092711)
Genome map
AA seq 807 aa AA seqDB search
MYSSSRKRCPKTKWALKLLTAAFLAASPAAKSAVNNAYDALIIEARKGNTQPALSWFALK
SALSNNQIADWLQIALWAGQDKQVITVYNRYRHQQLPARGYAAVAVAYRNLQQWQNSLTL
WQKALSLEPQNKDYQRGQILTLADAGHYDTALVKLKQLNSGAPDKANLLAEAYIYKLAGR
HQDELRAMTESLPENASTQQYPTEYVQALRNNQLAAAIDDANLTPDIRADIHAELVRLSF
MPTRSESERYAIADRALAQYAALEILWHDNPDRTAQYQRIQVDHLGALLTRDRYKDVISH
YQRLKKTGQIIPPWGQYWVASAYLKDHQPKKAQSIMTELFYHKETIAPDLSDEELADLFY
SHLESENYPGALTVTQHTINTSPPFLRLMGTPTSIPNDTWLQGHSFLSTVAKYSNDLPQA
EMTARELAYNAPGNQGLRIDYASVLQARGWPRAAENELKKAEVIEPRNINLEVEQAWTAL
TLQEWQQAAVLTHDVVEREPQDPGVVRLKRAVDVHNLAELRIAGSTGIDAEGPDSGKHDV
DLTTIVYSPPLKDNWRGFAGFGYADGQFSEGKGIVRDWLAGVEWRSRNIWLEAEYAERVF
NHEHKPGARLSGWYDFNDNWRIGSQLERLSHRVPLRAMKNGVTGNSAQAYVRWYQNERRK
YGVSWAFTDFSDSNQRHEVSLEGQERIWSSPYLIVDFLPSLYYEQNTEHDTPYYNPIKTF
DIVPAFEASHLLWRSYENSWEQIFSAGVGASWQKHYGTDVVTQLGYGQRISWNDVIDAGA
TLRWEKRPYDGDREHNLYVEFDMTFRF
NT seq 2424 nt NT seq  +upstreamnt  +downstreamnt
atgtattcaagtagcagaaaaaggtgcccgaaaaccaaatgggctttgaaacttcttact
gccgcatttttagcagcgagtcccgcggcgaagagtgctgttaataacgcctatgatgca
ttgattattgaagctcgcaagggtaatactcagccagctttgtcatggtttgcactaaaa
tcagcactcagcaataaccaaattgctgactggttacagattgccttatgggccgggcaa
gataaacaggttattaccgtttacaaccgctaccgtcatcagcaattaccagcgcgtggt
tatgcagctgtcgccgtcgcttatcgtaacctgcaacaatggcaaaactcgcttacactg
tggcaaaaggcgctctctctggagccgcaaaataaggattatcaacggggacaaatttta
accctggcagatgctggtcactatgatactgcgctggttaaacttaagcagcttaactct
ggagcaccggacaaagccaatttactcgcagaagcctatatctataaactggcggggcgt
catcaggatgaattacgggcgatgacagagtcattacctgaaaatgcatctacgcaacaa
tatcccacagaatacgtgcaggcattacgtaataatcaacttgctgccgcgattgacgat
gccaatttaacgccagatattcgcgctgatattcatgccgaactggtcagactgtcgttt
atgcctacgcgcagtgaaagtgaacgttatgccattgccgatcgcgccctcgcccaatac
gctgcattagaaattctgtggcacgataacccagaccgcactgcccagtaccagcgtatt
caggttgatcatcttggcgcgttattaactcgcgatcgttataaagacgttatttctcac
tatcagcgattaaaaaagacggggcaaattattccgccctgggggcaatattgggttgca
tcggcttatctcaaagatcatcagccgaaaaaagcacagtcaataatgaccgagctcttt
tatcacaaggagaccattgccccggatttatccgatgaagaacttgcggatctcttttac
agccacctggagagtgaaaattatccgggcgcgctaactgtcacccaacataccattaat
acttcgccgcctttccttcggttaatgggcacgcctacgagcatcccgaatgatacctgg
ttacaggggcattcgtttctctcaaccgtagcaaaatatagtaatgatcttcctcaggct
gaaatgacagccagagagcttgcttataacgcaccaggaaatcagggactgcgcattgat
tacgcgagtgtgttacaagcccgcggttggcctcgtgcagcagaaaatgaattaaaaaaa
gcagaagtgatcgagccacgtaatattaatctggaggttgaacaagcctggacagcatta
acgttacaagaatggcagcaggcagctgtcttaacgcacgatgttgtcgaacgtgaaccg
caagatcccggcgttgtacgattaaaacgtgcggttgatgtacataatcttgcagagctt
cgtatcgctggctcaacaggaattgatgccgaaggcccggatagtggtaaacatgatgtc
gacttaaccaccatcgtttattcaccaccgctgaaggataactggcgcggttttgctgga
ttcggttatgccgatggacaatttagcgaaggaaaagggattgttcgcgactggcttgcg
ggtgttgagtggcggtcacgtaatatctggctcgaggcagagtacgctgaacgcgttttc
aatcatgagcataaacccggcgcgcgcctgtctggctggtatgattttaatgataactgg
cgtattggttcgcaactggaacgcctctctcaccgcgttccattacgggcaatgaaaaat
ggtgttacaggcaacagtgctcaggcttatgttcgctggtatcaaaatgagcggcgtaag
tacggtgtctcctgggctttcactgatttttccgacagtaaccagcgtcatgaagtctca
cttgagggtcaggaacgcatctggtcttcaccatatttgattgtcgatttcctacccagt
ctgtattacgaacaaaatacagaacacgataccccatactacaaccctataaaaacgttc
gatattgttccggcatttgaggcaagccatttgttatggcgaagctatgaaaatagctgg
gagcaaatattcagcgcaggtgttggtgcctcctggcaaaaacattatggcacggatgtc
gtcacccaactcggctacgggcaacgcattagttggaatgacgtgattgatgctggcgca
acgctacgctgggaaaaacgaccttatgacggtgacagagaacacaacttatacgttgaa
ttcgatatgacattcagattttaa

DBGET integrated database retrieval system