KEGG   Escherichia coli K-12 W3110: JW1025
Entry
JW1025            CDS       T00068                                 

Gene name
csgA
Definition
(GenBank) cryptic curlin major subunit
  KO
K04334  major curlin subunit
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj02026  Biofilm formation - Escherichia coli
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02026 Biofilm formation - Escherichia coli
    JW1025 (csgA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ecj02044]
    JW1025 (csgA)
Secretion system [BR:ecj02044]
 Extracellular nucleation-precipitation pathway
  Curli assembly protein
   JW1025 (csgA)
SSDB
Motif
Pfam: Curlin_rpt
Other DBs
NCBI-ProteinID: BAA35832
UniProt: P28307
Position
1104688..1105143
AA seq 151 aa
MKLLKVAAIAAIVFSGSALAGVVPQYGGGGNHGGGGNNSGPNSELNIYQYGGGNSALALQ
TDARNSDLTITQHGGGNGADVGQGSDDSSIDLTQRGFGNSATLDQWNGKNSEMTVKQFGG
GNGAAVDQTASNSSVNVTQVGFGNNATAHQY
NT seq 456 nt   +upstreamnt  +downstreamnt
atgaaacttttaaaagtagcagcaattgcagcaatcgtattctccggtagcgctctggca
ggtgttgttcctcagtacggcggcggcggtaaccacggtggtggcggtaataatagcggc
ccaaattctgagctgaacatttaccagtacggtggcggtaactctgcacttgctctgcaa
actgatgcccgtaactctgacttgactattacccagcatggcggcggtaatggtgcagat
gttggtcagggctcagatgacagctcaatcgatctgacccaacgtggcttcggtaacagc
gctactcttgatcagtggaacggcaaaaattctgaaatgacggttaaacagttcggtggt
ggcaacggtgctgcagttgaccagactgcatctaactcctccgtcaacgtgactcaggtt
ggctttggtaacaacgcgaccgctcatcagtactaa

DBGET integrated database retrieval system