KEGG   Escherichia coli K-12 W3110: JW1040
Entry
JW1040            CDS       T00068                                 
Symbol
mdtG
Name
(GenBank) predicted drug efflux system
  KO
K08161  MFS transporter, DHA1 family, multidrug resistance protein
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW1040 (mdtG)
Transporters [BR:ecj02000]
 Major facilitator superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    JW1040 (mdtG)
SSDB
Motif
Pfam: MFS_1 Sugar_tr MFS_1_like ATG22
Other DBs
NCBI-ProteinID: BAA35851
UniProt: P25744
Position
complement(1115841..1117067)
AA seq 408 aa
MSPCENDTPINWKRNLIVAWLGCFLTGAAFSLVMPFLPLYVEQLGVTGHSALNMWSGIVF
SITFLFSAIASPFWGGLADRKGRKLMLLRSALGMGIVMVLMGLAQNIWQFLILRALLGLL
GGFVPNANALIATQVPRNKSGWALGTLSTGGVSGALLGPMAGGLLADSYGLRPVFFITAS
VLILCFFVTLFCIREKFQPVSKKEMLHMREVVTSLKNPKLVLSLFVTTLIIQVATGSIAP
ILTLYVRELAGNVSNVAFISGMIASVPGVAALLSAPRLGKLGDRIGPEKILITALIFSVL
LLIPMSYVQTPLQLGILRFLLGAADGALLPAVQTLLVYNSSNQIAGRIFSYNQSFRDIGN
VTGPLMGAAISANYGFRAVFLVTAGVVLFNAVYSWNSLRRRRIPQVSN
NT seq 1227 nt   +upstreamnt  +downstreamnt
atgtcaccctgtgaaaatgacacccctataaactggaaacgaaacctgatcgtcgcctgg
ctaggctgttttcttaccggtgccgccttcagtctggtaatgcccttcttacccctctac
gttgagcagcttggcgttaccggtcactccgccctgaatatgtggtccggtattgtcttc
agcattacatttttattttcggccatcgcctcaccgttttggggtggactcgccgaccgt
aaaggccgaaaactcatgctattacgctctgccctcggcatgggcatcgtgatggtgttg
atggggctggcacaaaatatctggcagtttttgatcctgcgggcgcttcttgggttactt
ggcggatttgtccccaacgctaatgctcttatcgccacacaagtaccgcgtaataaaagc
ggctgggcgctgggtacgctctccacaggcggcgttagtggtgcgttgctcggcccaatg
gctggcggcctgctcgccgatagctacggcttacgtccggtattctttattaccgccagt
gtgctcatactctgctttttcgtcaccctgttttgcatcagagaaaaattccagccggtc
agcaaaaaagagatgctgcacatgcgggaagtggtgacatcacttaaaaacccgaaactg
gtactcagcctgtttgtcactacgttaatcatccaggtggcgacgggctcaattgccccc
attctgacgctgtatgtccgcgaactggcgggtaacgtcagtaacgtcgcctttatcagt
ggcatgatcgcctcggtgccaggcgtggcggctctgctaagtgcaccacgactcggcaaa
cttggcgatcgaatcggacccgaaaagatcctgattacagcgctgatcttttctgtactg
ctgttgatcccaatgtcttacgttcagacgccattgcaacttgggattttacgttttttg
ctcggtgccgccgatggtgcactactccccgccgtacagacactgttggtttacaactcg
agcaaccagatcgccgggcgtatcttcagctataaccaatcgtttcgtgatattggcaac
gttaccggaccattgatgggagcagcgatttcagcgaactacggtttcagagcggtattt
ctcgtcaccgctggcgtagtgttattcaacgcagtctattcatggaacagtctacgtcgt
cgtcgaataccccaggtatcgaactga

DBGET integrated database retrieval system