KEGG   Escherichia coli K-12 W3110: JW1104
Entry
JW1104            CDS       T00068                                 

Symbol
lolE
Name
(GenBank) outer membrane-specific lipoprotein transporter subunit
  KO
K09808  lipoprotein-releasing system permease protein
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    JW1104 (lolE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW1104 (lolE)
Transporters [BR:ecj02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Lipoprotein-releasing transporter
    JW1104 (lolE)
SSDB
Motif
Pfam: FtsX MacB_PCD NrfD Neurensin
Other DBs
NCBI-ProteinID: BAA35938
UniProt: P75958
Structure
Position
1178897..1180141
AA seq 414 aa
MAMPLSLLIGLRFSRGRRRGGMVSLISVISTIGIALGVAVLIVGLSAMNGFERELNNRIL
AVVPHGEIEAVDQPWTNWQEALDHVQKVPGIAAAAPYINFTGLVESGANLRAIQVKGVNP
QQEQRLSALPSFVQGDAWRNFKAGEQQIIIGKGVADALKVKQGDWVSIMIPNSNPEHKLM
QPKRVRLHVAGILQLSGQLDHSFAMIPLADAQQYLDMGSSVSGIALKMTDVFNANKLVRD
AGEVTNSYVYIKSWIGTYGYMYRDIQMIRAIMYLAMVLVIGVACFNIVSTLVMAVKDKSG
DIAVLRTLGAKDGLIRAIFVWYGLLAGLFGSLCGVIIGVVVSLQLTPIIEWIEKLIGHQF
LSSDIYFIDFLPSELHWLDVFYVLVTALLLSLLASWYPARRASNIDPARVLSGQ
NT seq 1245 nt   +upstreamnt  +downstreamnt
atggcgatgcctttatcgttattaattggcctgcgttttagtcgcggacggcggcgcggc
ggcatggtgtcgctgatctccgttatttctaccattggcattgccctcggcgtggcggta
ttgatcgtcggcttaagcgcgatgaacggctttgaacgcgaactgaacaaccgtattctg
gcggtggtgccgcatggtgaaatcgaggcggtggatcagccgtggactaactggcaggaa
gcactggatcacgtgcaaaaagtgccgggtattgccgctgccgcgccgtatatcaatttc
accgggctggtggaaagtggcgcgaatcttcgcgcaatccaggtgaagggcgttaacccg
caacaggaacagcgtctgagcgcattaccctcgtttgtccagggcgatgcgtggcgcaat
tttaaagcgggcgaacagcaaattatcatcggcaaaggcgtggcggatgcgctgaaagtg
aagcagggggattgggtgtcgattatgatccccaactcgaatcccgagcataaactgatg
cagccaaaacgtgtgcgtttgcacgttgccggtattttgcagttgagtggtcaactcgat
cacagttttgccatgatcccgctggcggatgcccaacaatatcttgatatgggttccagc
gtgtcaggtattgcccttaaaatgacggatgttttcaacgccaataagctggtacgcgat
gcgggtgaagtgaccaacagctatgtttatattaaaagctggattggtacttacggctat
atgtatcgcgatatccaaatgatccgcgccattatgtatctggcgatggtactggtgatt
ggcgtggcctgtttcaacatcgtctccaccttagtgatggcggtgaaagacaagagtggc
gatatcgcagtattaagaacgctgggggcgaaagatggtttaattcgcgccatctttgtc
tggtatggattgctggcagggctgttcggcagcctgtgtggtgtgattatcggcgtagtg
gtttcactgcaacttaccccgattattgagtggattgaaaagttgatcggtcatcagttc
ctctccagcgatatctattttattgatttcctgccatcggaattgcactggctggacgtc
ttctacgtactggtcacagcattgttgctgagtcttttggcaagttggtatccggcgcgg
cgcgccagtaatattgaccctgcgcgagtccttagcggccagtaa

DBGET integrated database retrieval system