KEGG   Escherichia coli K-12 W3110: JW1126Help
Entry
JW1126            CDS       T00068                                 

Gene name
intE
Definition
(GenBank) predicted integrase
Organism
ecj  Escherichia coli K-12 W3110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arm-DNA-bind_1 Phage_integrase TGS
Motif
Other DBs
NCBI-ProteinID: BAA35969
UniProt: P75969
Position
complement(1201256..1202383)
Genome map
AA seq 375 aa AA seqDB search
MAARPRKNNVSVPNLYPLYSRKVNKVYWRYKHPVTGKFHALGTNEAEAIAIATEANTRLA
EQRTRQILAISDRIATSKGKAITTSTWLDRYQAIQDDRLKSGDIRLNTYKQKAKPVSLLR
ERAGMKLISAVDVRDIAQLLDEYIAAGRPRMAQVVRSVLIDVFKEAQHYGEVPPGYNPAL
ATKQPRRKITRQRLSLEEWKKIFDIADATHRYMGNAMLLALVTGQRLGDISRMKFSDIWD
DHLHVIQEKTGSKIAIPLSLRLNAINWSLRDVVARCRDYAVSAYLVHFFRSTSQAERGAQ
VKANTLTMNFSKARDLARIDWGEGSPATFHEQRSLSERLYKEQGLDTQKLLGHKTQQQTD
RYHDDRGKGWSKVAL
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggcagccagaccgcgtaagaataatgtttcagtccctaacttatatccgctttatagt
aggaaggtaaataaagtctattggcggtataagcatccagtgacaggaaaattccatgct
ttgggaacaaacgaagctgaagctatcgctattgccactgaggccaacactcgcctggct
gaacaaagaacccggcagattctggctatcagtgacaggatcgcaaccagcaaaggaaag
gctatcacaacgtcaacctggttagatcgctatcaagcgatccaggatgacaggcttaaa
agtggtgatataagactcaacacctataaacaaaaagctaaaccagtatccttgctcaga
gaacgagcaggaatgaagttgatctcagccgttgatgtcagagatatagcacaattgctt
gatgagtatatcgccgctgggcggccaagaatggcacaagtagttcgctccgtcctgatt
gatgttttcaaagaggcgcagcactacggagaagtacctcctggctataacccagcatta
gccactaaacaaccaagaagaaaaattacccgacaacggctgagccttgaagaatggaaa
aaaatcttcgatatcgcagacgctactcatcgttacatgggaaatgccatgctgttagcg
ctggttactggtcagcggttaggtgatatttcgcgtatgaaatttagcgatatttgggat
gatcatcttcatgtcattcaggaaaagaccgggagcaaaatcgcaattcctctttctctt
cgcctcaatgcgattaactggagtttacgcgatgtagtagcccgctgccgtgactatgca
gtcagtgcatacttagtgcatttttttcgttcaacttcacaagcagagcgcggagcgcag
gttaaagccaatacattgacgatgaattttagtaaagcgagagatttagcaagaattgac
tggggagagggttcacctgcgacattccatgagcaaaggtctttatctgaacgtctgtat
aaagaacaggggttagacacacaaaaactacttggtcataaaacacaacaacaaaccgat
cgttatcatgatgatcgaggtaaaggatggagcaaagtagcgttgtga

DBGET integrated database retrieval system