KEGG   Escherichia coli K-12 W3110: JW1214
Entry
JW1214            CDS       T00068                                 

Symbol
narK
Name
(GenBank) nitrate/nitrite transporter
  KO
K02575  MFS transporter, NNP family, nitrate/nitrite transporter
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj00910  Nitrogen metabolism
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    JW1214 (narK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW1214 (narK)
Transporters [BR:ecj02000]
 Major facilitator superfamily (MFS)
  Nitrate/nitrite transporters
   Nitrate/nitrite porter (NNP) family [TC:2.A.1.8]
    JW1214 (narK)
SSDB
Motif
Pfam: MFS_1
Other DBs
NCBI-ProteinID: BAA36091
UniProt: P10903
Structure
PDB: 
4U4V 4U4T 4U4W 4JR9 4JRE

Position
1279534..1280925
AA seq 463 aa
MSHSSAPERATGAVITDWRPEDPAFWQQRGQRIASRNLWISVPCLLLAFCVWMLFSAVAV
NLPKVGFNFTTDQLFMLTALPSVSGALLRVPYSFMVPIFGGRRWTAFSTGILIIPCVWLG
FAVQDTSTPYSVFIIISLLCGFAGANFASSMANISFFFPKQKQGGALGLNGGLGNMGVSV
MQLVAPLVVSLSIFAVFGSQGVKQPDGTELYLANASWIWVPFLAIFTIAAWFGMNDLATS
KASIKEQLPVLKRGHLWIMSLLYLATFGSFIGFSAGFAMLSKTQFPDVQILQYAFFGPFI
GALARSAGGALSDRLGGTRVTLVNFILMAIFSGLLFLTLPTDGQGGSFMAFFAVFLALFL
TAGLGSGSTFQMISVIFRKLTMDRVKAEGGSDERAMREAATDTAAALGFISAIGAIGGFF
IPKAFGSSLALTGSPVGAMKVFLIFYIACVVITWAVYGRHSKK
NT seq 1392 nt   +upstreamnt  +downstreamnt
atgagtcactcatccgcccccgaaagggctactggagctgtcattacagattggcgaccg
gaagatcctgcgttctggcaacaacgcggtcaacgtattgccagccgcaacctgtggatt
tccgttccctgtctgctgctggcgttttgcgtatggatgttgttcagcgctgttgcggtg
aacctaccgaaagtcggctttaattttacgaccgatcagctatttatgttgactgcgctg
ccttcggtttctggcgcgttattacgtgttccatactcctttatggttcctatcttcggt
ggtcgtcgctggacggcgttcagcaccggtattctgattattccttgcgtctggctgggt
tttgccgtgcaggatacctccacgccttatagcgtcttcatcatcatctctctgctatgc
ggctttgctggcgcgaacttcgcatccagtatggcaaacatcagcttcttctttccgaaa
cagaagcagggtggcgcgctgggtctgaatggtggtctgggaaacatgggcgtcagcgtc
atgcagttggttgctccgctggtggtatcactgtcgattttcgcagtatttggtagccag
ggcgtcaaacagccggatgggactgagctgtatctggcgaatgcgtcctggatatgggtg
ccgttccttgccatcttcaccattgcggcgtggtttggcatgaacgatcttgctacctcg
aaagcctccatcaaggagcagttgccggtactcaaacggggtcatctgtggattatgagc
ctgctgtatctggcaaccttcggctccttcatcggcttctccgcgggctttgcaatgctg
tcaaaaacgcagttcccggatgttcagattctgcaatacgctttcttcgggccgtttatt
ggtgcgctggcgcgttctgcaggtggtgcattatctgaccgtctgggcggaactcgtgtc
acgctggtgaactttattctgatggcgattttcagcggcctgctgttcctgaccttaccg
actgacgggcagggcggaagcttcatggcgttcttcgcggtcttcctggcgctgttcctg
acagctgggctgggtagtggttccactttccagatgatttcagtgatcttccgtaaactg
acaatggatcgcgtgaaagcagaagggggttctgacgaacgtgcgatgcgtgaagcggca
accgacacggcggcggcgctgggtttcatctctgcgattggcgcgattggtggcttcttt
atcccgaaagcgtttggtagctcgctggcattaacgggttcgccagtcggcgcaatgaag
gtatttttgattttctatatcgcctgcgtagtgattacctgggcggtatatggtcggcat
tctaaaaaataa

DBGET integrated database retrieval system