KEGG   Escherichia coli K-12 W3110: JW1289
Entry
JW1289            CDS       T00068                                 
Symbol
puuP
Name
(GenBank) putrescine importer
  KO
K14052  putrescine importer
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW1289 (puuP)
Transporters [BR:ecj02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   JW1289 (puuP)
SSDB
Motif
Pfam: AA_permease AA_permease_2
Other DBs
NCBI-ProteinID: BAA14856
UniProt: P76037
Position
complement(1359516..1360901)
AA seq 461 aa
MAINSPLNIAAQPGKTRLRKSLKLWQVVMMGLAYLTPMTVFDTFGIVSGISDGHVPASYL
LALAGVLFTAISYGKLVRQFPEAGSAYTYAQKSINPHVGFMVGWSSLLDYLFLPMINVLL
AKIYLSALFPEVPPWVWVVTFVAILTAANLKSVNLVANFNTLFVLVQISIMVVFIFLVVQ
GLHKGEGVGTVWSLQPFISENAHLIPIITGATIVCFSFLGFDAVTTLSEETPDAARVIPK
AIFLTAVYGGVIFIAASFFMQLFFPDISRFKDPDAALPEIALYVGGKLFQSIFLCTTFVN
TLASGLASHASVSRLLYVMGRDNVFPERVFGYVHPKWRTPALNVIMVGIVALSALFFDLV
TATALINFGALVAFTFVNLSVFNHFWRRKGMNKSWKDHFHYLLMPLVGALTVGVLWVNLE
STSLTLGLVWASLGGAYLWYLIRRYRKVPLYDGDRTPVSET
NT seq 1386 nt   +upstreamnt  +downstreamnt
atggctattaattcaccactgaatattgctgcgcaacccggcaaaacccgtctgcgaaaa
tcactgaaattgtggcaggtggtgatgatgggtctggcctatctcacgccgatgaccgta
tttgatacttttggtattgtctccggcattagcgacggtcacgttccggcgtcctatttg
ctggcgctggcgggtgtgctgtttaccgctatcagctacggcaaactggttcgccagttt
ccggaggccggttcggcctatacctacgcgcaaaagtcgattaacccgcacgtcggattt
atggtcggctggtcatcgctgctggattatctctttttgccgatgattaacgtcttgttg
gcgaaaatctatctctccgccctcttcccggaagtgccgccgtgggtgtgggtggtaacc
ttcgtcgccattttaaccgccgcgaatctgaagagcgtcaacctggtcgctaacttcaat
accctgtttgtactggtgcaaatctccatcatggtggtgtttatcttcctggtagttcag
ggactgcataaaggagaaggcgttggcaccgtctggtcacttcagccgtttatcagcgag
aacgcgcacctgatcccgattattaccggggcgacgattgtctgtttctccttcctcggt
ttcgatgcggtgaccacgctttcggaagagacgccggacgccgcacgcgtgatcccgaaa
gccatcttcctgacggcggtctacggtggcgttatctttatcgcggcgtcgttctttatg
cagctgttctttcccgatatcagccgctttaaagatccggatgccgcactgcctgaaatt
gcgctgtacgtcggcggcaagctcttccagtcgattttcctctgcaccacgtttgtgaac
acgttagcctctggcctggcttcacatgccagcgtgtcgcgtctgctgtatgtgatgggg
cgtgacaatgtgtttccggagcgcgtgtttggctatgtgcacccaaaatggcggactccg
gcactcaacgtcattatggtcgggattgtcgcgttgtcggcgctgttcttcgatttagtt
accgccacagcgttaattaacttcggtgctctggtggcgtttaccttcgtgaatctgtcg
gtgtttaatcatttctggcggcgtaaaggaatgaataaaagctggaaggatcacttccac
tatttgctgatgccgctggttggcgcgctgacggtgggtgtgctgtgggttaacctcgag
tcaacgtcactgacactcggtctggtatgggcttcgttaggcggcgcatatttatggtat
ctgatccgccgctatcgcaaagtgccgttgtatgatggtgacagaacgccggtgagtgaa
acgtaa

DBGET integrated database retrieval system