KEGG   Escherichia coli K-12 W3110: JW1442
Entry
JW1442            CDS       T00068                                 
Symbol
ydcZ
Name
(GenBank) predicted inner membrane protein
  KO
K09936  bacterial/archaeal transporter family-2 protein
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    JW1442 (ydcZ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW1442 (ydcZ)
Transporters [BR:ecj02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   JW1442 (ydcZ)
SSDB
Motif
Pfam: DMT_YdcZ
Other DBs
NCBI-ProteinID: BAE76443
UniProt: P76111
Position
complement(1519596..1520045)
AA seq 149 aa
MNQSLTLAFLIAAGIGLVVQNTLMVRITQTSSTILIAMLLNSLVGIVLFVSILWFKQGMA
GFGELVSSVRWWTLIPGLLGSFFVFASISGYQNVGAATTIAVLVASQLIGGLMLDIFRSH
GVPLRALFGPICGAILLVVGAWLVARRSF
NT seq 450 nt   +upstreamnt  +downstreamnt
atgaatcagtcgctcacccttgcttttttgattgccgccggaattggtctggttgtccag
aacacgctgatggtgcgcatcacccagacctcctctaccattctcatcgccatgttgctg
aactcactggtggggattgtgctctttgtttctattttatggtttaaacaaggcatggcg
gggtttggcgaactggtgtccagcgtgcgctggtggacacttatacctggcttgctggga
tcgttttttgtcttcgccagtatcagcggatatcagaatgtgggagcggcgacaactatt
gctgtactggtcgccagtcagctgattggcggtctgatgctggatatcttccgcagtcat
ggcgtaccactacgggcgttgttcggcccaatttgtggcgcaattttacttgtggttggc
gcctggttggtagccagacgctcattttaa

DBGET integrated database retrieval system