KEGG   Escherichia coli K-12 W3110: JW1531
Entry
JW1531            CDS       T00068                                 

Gene name
dcp
Definition
(GenBank) dipeptidyl carboxypeptidase II
  KO
K01284  peptidyl-dipeptidase Dcp [EC:3.4.15.5]
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ecj01002]
    JW1531 (dcp)
Enzymes [BR:ecj01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.5  peptidyl-dipeptidase Dcp
     JW1531 (dcp)
Peptidases and inhibitors [BR:ecj01002]
 Metallo peptidases
  Family M3
   JW1531 (dcp)
SSDB
Motif
Pfam: Peptidase_M3
Other DBs
NCBI-ProteinID: BAA15228
UniProt: P24171
Structure
PDB: 
1Y79

Position
complement(1627049..1629094)
AA seq 681 aa
MTTMNPFLVQSTLPYLAPHFDQIANHHYRPAFDEGMQQKRAEIAAIALNPQMPDFNNTIL
ALEQSGELLTRVTSVFFAMTAAHTNDELQRLDEQFSAELAELANDIYLNGELFARVDAVW
QRRESLGLDSESIRLVEVIHQRFVLAGAKLAQADKAKLKVLNTEAATLTSQFNQRLLAAN
KSGGLVVNDIAQLAGMSEQEIALAAEAAREKGLDNKWLIPLLNTTQQPALAEMRDRATRE
KLFIAGWTRAEKNDANDTRAIIQRLVEIRAQQATLLGFPHYAAWKIADQMAKTPEAALNF
MREIVPAARQRASDELASIQAVIDKQQGGFSAQPWDWAFYAEQVRREKFDLDEAQLKPYF
ELNTVLNEGVFWTANQLFGIKFVERFDIPVYHPDVRVWEIFDHNGVGLALFYGDFFARDS
KSGGAWMGNFVEQSTLNKTHPVIYNVCNYQKPAAGEPALLLWDDVITLFHEFGHTLHGLF
ARQRYATLSGTNTPRDFVEFPSQINEHWATHPQVFARYARHYQSGAAMPDELQQKMRNAS
LFNKGYEMSELLSAALLDMRWHCLEENEAMQDVDDFELRALVAENMDLPAIPPRYRSSYF
AHIFGGGYAAGYYAYLWTQMLADDGYQWFVEQGGLTRENGLRFREAILSRGNSEDLERLY
RQWRGKAPKIMPMLQHRGLNI
NT seq 2046 nt   +upstreamnt  +downstreamnt
atgacaacaatgaatcctttccttgtgcaaagcacactgccgtatctggctccccatttt
gatcaaattgccaatcatcactatcgcccggcattcgatgagggaatgcagcaaaagcgg
gcagaaattgctgccatcgcgcttaacccgcaaatgcctgatttcaacaatactattctg
gcactggaacaaagcggagaattacttacccgcgttaccagcgtcttttttgcgatgact
gcggcgcataccaatgatgaattacagcgtcttgacgagcagttttccgctgaactggcg
gaactggctaatgatatctatctgaacggtgaattattcgcgcgggtagatgctgtctgg
cagcgccgtgaatccctggggcttgatagtgaatccatccgcctggtggaggtgattcat
caacgttttgtccttgccggagccaaacttgcgcaagctgataaagcaaaattaaaagta
ctgaatacagaagctgcgaccctgaccagccagtttaaccagcgattactggcagcaaat
aaatccggcggtctggttgtgaacgatatcgcgcagctggcaggaatgagtgagcaagag
attgcgctggcggcagaggcggctcgcgagaaaggtctggataacaaatggctgattccg
ctgctgaataccacccaacaaccggcgcttgccgaaatgcgcgatcgtgcgacgcgtgaa
aaactgtttattgcgggctggacgcgagcggaaaaaaatgatgccaatgatacccgcgct
atcattcaacgtctggtggagatccgtgcacaacaggcaacactacttggttttcctcat
tatgccgcatggaaaatcgccgatcagatggcaaaaacacctgaagcagcacttaacttt
atgcgggaaattgttccagcggcgcgtcaacgtgcgagcgatgaattagcctccatacag
gcggttatcgataagcagcagggcgggtttagcgcgcagccgtgggactgggcattttat
gcggaacaggtacggcgggagaaatttgatcttgatgaggcgcagctcaagccatatttt
gaattaaacacggtgttaaatgaaggtgtattctggaccgcgaatcagctcttcggtatt
aagtttgtcgaacgttttgatattcctgtctaccatcctgacgttcgtgtgtgggaaatt
tttgatcataatggcgtggggctggcgttattttacggtgatttcttcgcccgtgattca
aaaagcggcggtgcatggatgggcaattttgttgagcaatcaacgcttaataaaacacat
ccggtaatttataacgtctgcaattatcagaaacccgctgccggtgagcctgcgttgtta
ctctgggatgatgtcataaccttattccatgaatttggtcatacgctgcacggccttttt
gcccgccagcgttatgccacgctttccggcaccaacacgccgcgtgattttgtcgaattt
ccgtcgcaaatcaacgaacactgggcaacgcatccgcaggtattcgctcgctacgcccgg
cattatcagagcggggcagcaatgcctgacgaactgcaacagaaaatgcgtaatgccagc
ctgttcaacaaagggtatgagatgagcgaactgcttagcgccgcacttctcgatatgcgc
tggcattgcctggaagaaaacgaagcaatgcaggatgtcgatgattttgaattgcgggcg
ctggtggcggaaaatatggatcttcctgctataccgccacgctatcgcagcagttatttc
gcccatatttttggtggcggatatgctgcaggttattacgcttatctgtggacgcaaatg
ttggccgatgatggttatcagtggtttgttgagcagggcggattaacgcgtgaaaatggg
ctgcgttttcgcgaggcgatcctttccagaggtaacagcgaagatctggaacgcctgtat
cgacaatggcgcggtaaggcacctaagattatgccgatgctgcaacatcgtggcttgaac
atataa

DBGET integrated database retrieval system