KEGG   Escherichia coli K-12 W3110: JW1535Help
Entry
JW1535            CDS       T00068                                 

Gene name
ydfI
Definition
(GenBank) predicted mannonate dehydrogenase
Organism
ecj  Escherichia coli K-12 W3110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh
Motif
Other DBs
NCBI-ProteinID: BAA15243
UniProt: P77260
Structure
PDB: 

Position
complement(1631167..1632627)
Genome map
AA seq 486 aa AA seqDB search
MGNNLLSAKATLPVYDLNNLAPRIVHLGFGAFHRAHQGVYADILATEHFSDWGYYEVNLI
GGEQQIADLQQQDNLYTVAEMSADVWTARVVGVVKKALHVQIDGLETVLAAMCEPQIAIV
SLTITEKGYFHSPATGQLMLDHPMVAADVQNPHQPKTATGVIVEALARRKAAGLPAFTVM
SCDNMPENGHVMRDVVTSYAQAVDVKLAQWIEDNVTFPSTMVDRIVPAVTEDTLAKIEQL
TGVRDPAGVACEPFRQWVIEDNFVAGRPEWEKAGAELVSDVLPYEEMKLRMLNGSHSFLA
YLGYLAGYQHINDCMEDEHYRYAAYGLMLQEQAPTLKVQGVDLQDYANRLIARYSNPALR
HRTWQIAMDGSQKLPQRMLDSVRWHLAHDSKFDLLALGVAGWMRYVGGVDEQGNPIEISD
PLLPVIQKAVQSSAEGKARVQSLLAIKAIFGDDLPDNSLFTARVTETYLSLLAHGAKATV
AKYSVK
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgggaaataatttgttatcagcaaaagcgacactccctgtttatgatcttaataacctg
gctccaagaattgttcatttaggctttggtgcatttcaccgtgcgcatcagggtgtgtat
gccgatattcttgctacggaacatttcagtgactggggatattatgaggtcaacttaatc
ggcggcgaacagcaaattgccgatttacaacagcaagataatctttataccgttgcggaa
atgtcggccgatgtgtggacggctcgcgtcgttggcgtcgttaaaaaagccttgcacgta
cagatagatggcttagaaaccgtgttggcagcgatgtgtgaaccgcaaatcgcgattgtc
tctctgacaatcaccgaaaaagggtatttccactctccggcgaccggacagttaatgctc
gatcacccgatggtagctgccgacgtgcaaaatccccaccagccgaaaacagcaacaggg
gtgattgttgaggcgctggctcgccgtaaagcggcaggacttcccgcatttaccgtcatg
tcatgtgacaacatgccagaaaacggtcatgttatgcgtgacgttgtcacttcctacgca
caagccgttgatgtaaaactggcacaatggatcgaagataacgtgactttcccatcaaca
atggtggaccgtattgtgcccgcagtgacagaggatacgctggcgaaaatcgaacaactt
accggtgtgcgcgatcctgcgggcgttgcctgtgaacctttccgccagtgggtaatagaa
gataactttgttgccggacgtccggaatgggaaaaagcgggagccgaactggttagcgat
gtgctgccttatgaagagatgaagttgcgcatgctcaacggcagtcattcattcctggcg
tatctggggtatcttgcaggatatcagcacattaatgactgtatggaagatgaacattat
cgttatgcggcgtatggcttgatgttgcaggaacaagcgccgacgttgaaagtgcagggc
gttgatttgcaagattacgctaaccgattaattgcacgctatagcaacccggcgttacgt
catcgaacctggcagattgcgatggatggtagccagaaattgccacagcggatgttggat
tctgttcgctggcatctggcgcatgacagcaagttcgatctgctggcgctgggcgtcgcg
ggttggatgcgttatgtcggtggtgttgatgaacagggaaatccgatagaaatcagtgac
ccactgttacctgttattcagaaggctgtacaaagtagtgccgaagggaaagcgcgcgtc
cagtcattgctggcgattaaggcgatctttggtgatgatttgccagacaatagtttgttt
actgcaagagtgacggaaacgtacttgtctttattagcgcatggcgcgaaagcgaccgtg
gcaaaatattccgtgaagtaa

DBGET integrated database retrieval system